KEGG   Geobacillus sp. GHH01: GHH_c27490Help
Entry
GHH_c27490        CDS       T02455                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00020  Citrate cycle (TCA cycle)
ggh00190  Oxidative phosphorylation
ggh00650  Butanoate metabolism
ggh01100  Metabolic pathways
ggh01110  Biosynthesis of secondary metabolites
ggh01120  Microbial metabolism in diverse environments
ggh01130  Biosynthesis of antibiotics
ggh01200  Carbon metabolism
Module
ggh_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ggh_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ggh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    GHH_c27490 (sdhA)
   00650 Butanoate metabolism
    GHH_c27490 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GHH_c27490 (sdhA)
Enzymes [BR:ggh01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     GHH_c27490 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     GHH_c27490 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like NAD_binding_8 FAD_binding_3 FAD_oxidored AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AGE23260
UniProt: L7ZZY1
LinkDB All DBs
Position
complement(2740488..2742245)
Genome map
AA seq 585 aa AA seqDB search
MKKGKIIVVGGGLAGLMATIKIAEAGVPVELFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWEHFDDTVYGGDFLANQPPVKAMCEAAPGIIYMLDRMGVMFNRTPEGLLDFRRFGGTQ
HHRTAYAGATTGQQILYALDEQVRRHEVAGLVTKYEHWEFLGVVLDDEQICRGIVAQDLR
SMEIKAFPADAVILATGGPGIIFGKSTNSVINTGSAASIAYQQGVYYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPAYGNLVPRDIAAREIFHVCVDLK
LGINGENMVYLDLSHKDPKELDVKLGGIIEIYEKFMGEDPRKVPMKVFPAVHYSMGGLWV
DYDQMTNIKGLFAAGECDYSIHGANRLGANSLLSAIYGGMVAGPNAVRYIRGLEKSADAM
PSTLYDSYVKREQEKWENILAMDGTENAYVLHKELGEWMTANVTIVRYNDRLLKTDEKIQ
ELMERYKNISVTDTSRWSNQGATFIRQLYNMLQLARVITLGAYYRNESRGAHYKPEFPER
NDEEWLKTTMARYTPDGPAFHYEDVDVSLIKPRKRDYSKKKEEVK
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagggaaaatcatcgttgttggcggtgggttggccggtttgatggccacgatt
aaaatcgccgaagcaggagtgcctgtcgaactgttttcgctcgttccggtaaagcgttct
cactccgtctgtgcccaaggcggcattaacggagcggtcaacacgaaaggggaaggcgac
tcgccgtgggagcattttgacgacaccgtctatggcggggacttcttggcgaaccagcct
ccggtcaaagcgatgtgtgaagcggcgccggggatcatttacatgctcgatcggatgggc
gtcatgttcaaccggacgccggaagggttgcttgatttccgtcgtttcggggggacgcag
catcaccggaccgcctatgctggagccacgaccgggcagcaaattttgtatgcacttgat
gaacaggtgcgccgccatgaagtggccgggctcgtcacgaagtacgagcattgggagttt
ttaggcgtcgttttggatgacgagcaaatttgccgcggcatcgtcgcacaagatttgcgg
tccatggaaatcaaagcgtttccagccgatgccgtcattttggcgaccggcggcccgggg
atcatttttgggaaatcgacgaactcggtcatcaacactggttcagcggcttcgatcgcc
tatcagcaaggcgtttactacgcgaacggcgagttcatccaaattcacccgaccgcgatc
ccaggcgatgacaagcttcggttgatgagcgaatcggcgcgcggggaaggcggacgcatt
tggacgtataaggacgggaaaccgtggtacttccttgaggaaaaatatccggcttacgga
aacttggtgccgcgcgacatcgccgcccgggaaattttccacgtctgcgtcgatttgaag
ctcggcatcaacggcgaaaacatggtgtatttggatttgtcacataaagatccgaaagag
ttggatgtcaagctcggcggcattatcgaaatttacgagaagttcatgggcgaagacccg
cgcaaagtgccaatgaaggtgttcccggccgttcactactcgatgggcggcttatgggtc
gactatgaccaaatgacgaacatcaaagggttgtttgctgccggcgagtgcgattattcg
attcacggcgcgaaccgcctcggggcaaactcgcttctgtcggcgatttacggcggaatg
gtcgccggcccgaacgccgtccgctacatccgcggtctcgagaaatcggccgatgcgatg
ccgtcgacgttatacgacagctatgtgaaacgggagcaagaaaagtgggaaaacattttg
gcgatggacggcacggaaaacgcctacgtgctgcataaagagctcggtgaatggatgacg
gcaaacgtgacgatcgtccgctacaacgaccggctgctgaagaccgatgagaaaattcaa
gagctgatggagcggtataaaaacatcagcgtcaccgatacgtcgagatggagcaaccaa
ggagcgacgtttatccgccagctgtacaacatgctgcagctcgcccgcgtcattacgctt
ggcgcttactatcgcaatgaaagccgcggcgcgcactacaagccggagtttccggagcgc
aacgacgaagaatggctgaaaacgacgatggcccgctacacgccagacggtccggcgttc
cattatgaagacgttgacgtctcgttgattaaaccgcgcaagcgcgactacagcaaaaag
aaagaggaagtgaagtaa

DBGET integrated database retrieval system