KEGG   Geobacillus sp. GHH01: GHH_c32780Help
Entry
GHH_c32780        CDS       T02455                                 

Gene name
acoD
Definition
(GenBank) acetaldehyde dehydrogenase 2
  KO
K00138  aldehyde dehydrogenase [EC:1.2.1.-]
Organism
ggh  Geobacillus sp. GHH01
Pathway
ggh00010  Glycolysis / Gluconeogenesis
ggh00620  Pyruvate metabolism
ggh01100  Metabolic pathways
ggh01110  Biosynthesis of secondary metabolites
ggh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ggh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GHH_c32780 (acoD)
   00620 Pyruvate metabolism
    GHH_c32780 (acoD)
Enzymes [BR:ggh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     GHH_c32780 (acoD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-ProteinID: AGE23769
UniProt: L8A2L1
LinkDB All DBs
Position
3269055..3270575
Genome map
AA seq 506 aa AA seqDB search
MIYAQPGQPGALVTFKKRYENFIGGKWVPPVDGEYFENITPITGQPYCEVPRSKAADIEL
ALDAAHAAKDAWGRTSPAERARLLNKIADRMEEHLEMLAVAETWENGKPIRETLAADIPL
AIDHFRYFASCIRAQEGTISEIDHDTVAYHFKEPLGVVGQIIPWNFPILMAAWKLAPALA
AGNCVVLKPAEQTPTSILVLIELIEDLLPPGVVNIVNGFGLEAGKPLASNPRVAKVAFTG
ETTTGRLIMQYASQNIVPVTLELGGKSPNIFFADVMDKDDDFLDKALEGFTMFALNQGEV
CTCPSRALIHESIYDAFMERALERVKQIKQGNPLDTETMIGAQASSEQLEKILSYIDIGK
QEGAELLIGGERNMLEGELSGGYYVKPTVFKGHNKMRIFQEEIFGPVLAVTTFKDHDEAL
SIANETLYGLGAGVWTRDINTAYRFGRGIQAGRVWTNCYHVYPAHAAFGGYKMSGIGRET
HKMMLDHYQQTKNLLVSYSPKKLGLF
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgatctacgcacaaccaggccagccaggcgcgcttgtcacatttaaaaagcgctacgaa
aacttcattggcggcaaatgggtgccgccggtcgacggcgagtattttgaaaacatcacg
cccatcaccggacagccgtattgcgaagtgccgcgctccaaagcggcggacatcgaactg
gcgcttgacgccgcccacgcggccaaagacgcctggggacgcacgtctccagcggagcgc
gcccgtttgctgaacaaaatcgccgatcggatggaagaacatttggaaatgctggccgtc
gccgaaacgtgggaaaacggcaagccgatccgcgagacgctcgcggctgacattccgctt
gccatcgaccatttccgctattttgccagctgcatccgcgcgcaagaaggcacgatttca
gaaatcgatcacgacacagtcgcctatcatttcaaagaaccgctcggcgtcgtcgggcaa
atcatcccgtggaacttcccgattctcatggcggcatggaaactcgccccggcattggcc
gcaggcaactgcgtcgtgttgaaaccggcggagcaaacgccgacgtcgatcctcgttctc
atcgaactcatcgaagatttgctcccacctggcgtcgtcaacatcgtcaacggctttggc
ttagaagccggcaagccgctcgcctcgaacccgcgcgtggcgaaagtggcattcaccggc
gaaacgacgaccggacggctcatcatgcaatacgcctcgcaaaacatcgtgccggttacg
ctcgagctgggcggcaagtccccgaacattttcttcgctgatgtgatggacaaagacgat
gactttcttgataaagcgcttgaaggctttacgatgttcgccttaaaccaaggcgaagtg
tgcacatgcccgtcgcgcgccctcatccatgagtcgatttacgacgcctttatggaacgg
gcgcttgagcgcgtcaagcaaatcaagcaaggcaatccgctcgatacggaaacgatgatc
ggcgcccaagcctcctccgaacagctcgagaaaattttgtcatacatcgacatcggcaaa
caagaaggcgccgaacttttgatcggcggcgagcggaacatgctcgaaggagaactgtcc
ggcggctattacgtcaagccgaccgttttcaaagggcataacaaaatgcgcattttccaa
gaagaaattttcggcccagtgctcgcggtcacgacgtttaaagatcatgacgaagcgctt
tcgatcgccaatgagacgctgtacggccttggcgccggcgtctggacgcgcgacatcaac
accgcgtaccgcttcggccgcggcatccaggctggccgcgtctggacgaactgctaccac
gtctatccggcccatgcggcgttcggcggctacaaaatgtccggcatcggccgcgaaacg
cacaaaatgatgcttgaccattaccaacaaacgaaaaacttgctcgtcagctattcgccg
aaaaaactgggcttgttctaa

DBGET integrated database retrieval system