KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101123865
Entry
101123865         CDS       T02442                                 

Gene name
CGA
Definition
(RefSeq) glycoprotein hormones alpha chain
  KO
K08522  glycoprotein hormones alpha chain
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04024  cAMP signaling pathway
ggo04080  Neuroactive ligand-receptor interaction
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04917  Prolactin signaling pathway
ggo04918  Thyroid hormone synthesis
ggo04923  Regulation of lipolysis in adipocytes
ggo04929  GnRH secretion
ggo05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101123865 (CGA)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101123865 (CGA)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101123865 (CGA)
   04929 GnRH secretion
    101123865 (CGA)
   04912 GnRH signaling pathway
    101123865 (CGA)
   04913 Ovarian steroidogenesis
    101123865 (CGA)
   04917 Prolactin signaling pathway
    101123865 (CGA)
   04918 Thyroid hormone synthesis
    101123865 (CGA)
 09160 Human Diseases
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101123865 (CGA)
SSDB
Motif
Pfam: Hormone_6
Other DBs
NCBI-GeneID: 101123865
NCBI-ProteinID: XP_004044424
Ensembl: ENSGGOG00000027560
UniProt: A0A2I2Y6D9
LinkDB
Position
6
AA seq 147 aa
MDCYRKYAVIFLVTLSVFLHVLHSAPDVQEIGFHHVAQAALKLLSSSNPPTKASQSARIT
DCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCCVAKSY
NRVTVMGGFKVENHTACHCSTCYYHKS
NT seq 444 nt   +upstreamnt  +downstreamnt
atggattgctacagaaaatatgcagttatctttctggtcacattgtcggtgtttctgcac
gttctccattccgctcctgatgtgcaggagatagggtttcaccatgttgcccaggctgct
ctcaaactcctgagctcaagcaatccacccactaaggcctcccaaagtgctaggattaca
gattgcccagaatgcacgctacaggaaaacccattcttctcccagccgggtgccccaata
cttcagtgcatgggctgctgcttctctagagcatatcccactccactaaggtccaagaag
acgatgttggtccaaaaaaacgtcacctcagagtccacttgctgtgtagctaaatcatat
aacagggtcacagtaatggggggtttcaaagtggagaaccacacggcgtgccactgcagt
acttgttattatcacaaatcttaa

DBGET integrated database retrieval system