KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124029
Entry
101124029         CDS       T02442                                 

Gene name
CDC42
Definition
(RefSeq) cell division control protein 42 homolog isoform X1
  KO
K04393  cell division control protein 42
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04062  Chemokine signaling pathway
ggo04144  Endocytosis
ggo04360  Axon guidance
ggo04370  VEGF signaling pathway
ggo04510  Focal adhesion
ggo04520  Adherens junction
ggo04530  Tight junction
ggo04660  T cell receptor signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04670  Leukocyte transendothelial migration
ggo04722  Neurotrophin signaling pathway
ggo04810  Regulation of actin cytoskeleton
ggo04912  GnRH signaling pathway
ggo04932  Non-alcoholic fatty liver disease
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo05100  Bacterial invasion of epithelial cells
ggo05132  Salmonella infection
ggo05135  Yersinia infection
ggo05165  Human papillomavirus infection
ggo05200  Pathways in cancer
ggo05203  Viral carcinogenesis
ggo05205  Proteoglycans in cancer
ggo05211  Renal cell carcinoma
ggo05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101124029 (CDC42)
   04014 Ras signaling pathway
    101124029 (CDC42)
   04015 Rap1 signaling pathway
    101124029 (CDC42)
   04370 VEGF signaling pathway
    101124029 (CDC42)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101124029 (CDC42)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101124029 (CDC42)
   04520 Adherens junction
    101124029 (CDC42)
   04530 Tight junction
    101124029 (CDC42)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101124029 (CDC42)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101124029 (CDC42)
   04666 Fc gamma R-mediated phagocytosis
    101124029 (CDC42)
   04670 Leukocyte transendothelial migration
    101124029 (CDC42)
   04062 Chemokine signaling pathway
    101124029 (CDC42)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101124029 (CDC42)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101124029 (CDC42)
  09158 Development and regeneration
   04360 Axon guidance
    101124029 (CDC42)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101124029 (CDC42)
   05205 Proteoglycans in cancer
    101124029 (CDC42)
   05203 Viral carcinogenesis
    101124029 (CDC42)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101124029 (CDC42)
   05211 Renal cell carcinoma
    101124029 (CDC42)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    101124029 (CDC42)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101124029 (CDC42)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101124029 (CDC42)
   05135 Yersinia infection
    101124029 (CDC42)
   05100 Bacterial invasion of epithelial cells
    101124029 (CDC42)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101124029 (CDC42)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Small GTPases and associated proteins
   Rho GTPases
    101124029 (CDC42)
 Endocytosis
  Lipid raft mediated endocytosis
   GRAF1-dependent endocytosis
    101124029 (CDC42)
  Macropinocytosis
   Ras GTPases
    101124029 (CDC42)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    101124029 (CDC42)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   101124029 (CDC42)
  Exosomal proteins of breast milk
   101124029 (CDC42)
GTP-binding proteins [BR:ggo04031]
 Small (monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    101124029 (CDC42)
SSDB
Motif
Pfam: Ras Roc Arf PET117 GTP_EFTU
Other DBs
NCBI-GeneID: 101124029
NCBI-ProteinID: XP_018867865
Ensembl: ENSGGOG00000024439
UniProt: A0A2I2Z7E7
LinkDB
Position
1
AA seq 191 aa
MQTIKCVVVGDGAVGKTCLLISYTTNKFPSEYVPTVFDNYAVTVMIGGEPYTLGLFDTAG
QEDYDRLRPLSYPQTDVFLVCFSVVSPSSFENVKEKWVPEITHHCPKTPFLLVGTQIDLR
DDPSTIEKLAKNKQKPITPETAEKLARDLKAVKYVECSALTQKGLKNVFDEAILAALEPP
EPKKSRRCVLL
NT seq 576 nt   +upstreamnt  +downstreamnt
atgcagacaattaagtgtgttgttgtgggcgatggtgctgttggtaaaacatgtctcctg
atatcctacacaacaaacaaatttccatcagaatatgtaccgactgtttttgacaactat
gcagtcacagttatgattggtggagaaccatatactcttggactttttgatactgcaggg
caagaggattatgacagattacgaccgctgagttatccacaaacagatgtatttctagtc
tgtttttcagtggtctctccatcttcatttgaaaatgtgaaagaaaagtgggtgcctgag
ataactcaccactgtccaaagactcctttcttgcttgttgggactcaaattgatctcaga
gatgacccctctactattgagaaacttgccaagaacaaacagaagcctatcactccagag
actgctgaaaagctggcccgtgacctgaaggctgtcaagtatgtggagtgttctgcactt
acacagaaaggcctaaagaatgtatttgacgaagcaatattggctgccctggagcctcca
gaaccgaagaagagccgcaggtgtgtgctgctatga

DBGET integrated database retrieval system