KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124033
Entry
101124033         CDS       T02442                                 

Gene name
MAPK8
Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X2
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04024  cAMP signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04137  Mitophagy - animal
ggo04140  Autophagy - animal
ggo04141  Protein processing in endoplasmic reticulum
ggo04210  Apoptosis
ggo04215  Apoptosis - multiple species
ggo04217  Necroptosis
ggo04310  Wnt signaling pathway
ggo04380  Osteoclast differentiation
ggo04510  Focal adhesion
ggo04530  Tight junction
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04722  Neurotrophin signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04728  Dopaminergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04910  Insulin signaling pathway
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04917  Prolactin signaling pathway
ggo04920  Adipocytokine signaling pathway
ggo04926  Relaxin signaling pathway
ggo04930  Type II diabetes mellitus
ggo04931  Insulin resistance
ggo04932  Non-alcoholic fatty liver disease
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04935  Growth hormone synthesis, secretion and action
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05016  Huntington disease
ggo05017  Spinocerebellar ataxia
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05135  Yersinia infection
ggo05142  Chagas disease
ggo05145  Toxoplasmosis
ggo05152  Tuberculosis
ggo05161  Hepatitis B
ggo05162  Measles
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05171  Coronavirus disease - COVID-19
ggo05200  Pathways in cancer
ggo05210  Colorectal cancer
ggo05212  Pancreatic cancer
ggo05231  Choline metabolism in cancer
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101124033 (MAPK8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101124033 (MAPK8)
   04012 ErbB signaling pathway
    101124033 (MAPK8)
   04014 Ras signaling pathway
    101124033 (MAPK8)
   04310 Wnt signaling pathway
    101124033 (MAPK8)
   04668 TNF signaling pathway
    101124033 (MAPK8)
   04068 FoxO signaling pathway
    101124033 (MAPK8)
   04071 Sphingolipid signaling pathway
    101124033 (MAPK8)
   04024 cAMP signaling pathway
    101124033 (MAPK8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101124033 (MAPK8)
   04137 Mitophagy - animal
    101124033 (MAPK8)
  09143 Cell growth and death
   04210 Apoptosis
    101124033 (MAPK8)
   04215 Apoptosis - multiple species
    101124033 (MAPK8)
   04217 Necroptosis
    101124033 (MAPK8)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101124033 (MAPK8)
   04530 Tight junction
    101124033 (MAPK8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101124033 (MAPK8)
   04621 NOD-like receptor signaling pathway
    101124033 (MAPK8)
   04622 RIG-I-like receptor signaling pathway
    101124033 (MAPK8)
   04625 C-type lectin receptor signaling pathway
    101124033 (MAPK8)
   04660 T cell receptor signaling pathway
    101124033 (MAPK8)
   04658 Th1 and Th2 cell differentiation
    101124033 (MAPK8)
   04659 Th17 cell differentiation
    101124033 (MAPK8)
   04657 IL-17 signaling pathway
    101124033 (MAPK8)
   04664 Fc epsilon RI signaling pathway
    101124033 (MAPK8)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101124033 (MAPK8)
   04920 Adipocytokine signaling pathway
    101124033 (MAPK8)
   04912 GnRH signaling pathway
    101124033 (MAPK8)
   04914 Progesterone-mediated oocyte maturation
    101124033 (MAPK8)
   04917 Prolactin signaling pathway
    101124033 (MAPK8)
   04926 Relaxin signaling pathway
    101124033 (MAPK8)
   04935 Growth hormone synthesis, secretion and action
    101124033 (MAPK8)
  09156 Nervous system
   04728 Dopaminergic synapse
    101124033 (MAPK8)
   04723 Retrograde endocannabinoid signaling
    101124033 (MAPK8)
   04722 Neurotrophin signaling pathway
    101124033 (MAPK8)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101124033 (MAPK8)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101124033 (MAPK8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101124033 (MAPK8)
   05231 Choline metabolism in cancer
    101124033 (MAPK8)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101124033 (MAPK8)
   05212 Pancreatic cancer
    101124033 (MAPK8)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101124033 (MAPK8)
   05012 Parkinson disease
    101124033 (MAPK8)
   05016 Huntington disease
    101124033 (MAPK8)
   05017 Spinocerebellar ataxia
    101124033 (MAPK8)
   05020 Prion disease
    101124033 (MAPK8)
   05022 Pathways of neurodegeneration - multiple diseases
    101124033 (MAPK8)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101124033 (MAPK8)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101124033 (MAPK8)
   04932 Non-alcoholic fatty liver disease
    101124033 (MAPK8)
   04931 Insulin resistance
    101124033 (MAPK8)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101124033 (MAPK8)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101124033 (MAPK8)
   05135 Yersinia infection
    101124033 (MAPK8)
   05133 Pertussis
    101124033 (MAPK8)
   05152 Tuberculosis
    101124033 (MAPK8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101124033 (MAPK8)
   05170 Human immunodeficiency virus 1 infection
    101124033 (MAPK8)
   05161 Hepatitis B
    101124033 (MAPK8)
   05171 Coronavirus disease - COVID-19
    101124033 (MAPK8)
   05162 Measles
    101124033 (MAPK8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101124033 (MAPK8)
   05169 Epstein-Barr virus infection
    101124033 (MAPK8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101124033 (MAPK8)
   05142 Chagas disease
    101124033 (MAPK8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101124033 (MAPK8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101124033 (MAPK8)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101124033 (MAPK8)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101124033 (MAPK8)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2 DUF530
Other DBs
NCBI-GeneID: 101124033
NCBI-ProteinID: XP_004049430
Ensembl: ENSGGOG00000011771
UniProt: A0A2I2ZPX0
LinkDB
Position
10
AA seq 427 aa
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIKGGVLFPGTDHIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEASA
GPLGCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgagcagaagcaagcgagacaacaatttttatagtgtagagattggagattctacattc
acagtcctgaaacgatatcagaatttaaaacctataggctcaggagctcaaggaatagta
tgcgcagcttatgatgccattcttgaaagaaatgttgcaatcaagaagctaagccgacca
tttcagaatcagactcatgccaagcgggcctacagagagctagttcttatgaaatgtgtt
aatcacaaaaatataattggccttttgaatgttttcacaccacagaaatccctagaagaa
tttcaagatgtttacatagtcatggagctcatggatgcaaatctttgccaagtgattcag
atggagctagatcatgaaagaatgtcctaccttctctatcagatgctgtgtggaatcaag
caccttcattctgctggaattattcatcgggacttaaagcccagtaatatagtagtaaaa
tctgactgcactttgaagattcttgacttcggtctggccaggactgcaggaacgagtttt
atgatgacgccttacgtagtgactcgctactacagagcaccagaggtcatcctcggcatg
ggctacaaggaaaacgttgacatttggtcagttgggtgcatcatgggagaaatgatcaaa
ggtggtgttttgttcccaggtacagatcatattgatcagtggaataaagttattgaacag
cttggaacaccatgtcctgaattcatgaagaagctgcaaccaacagtaaggacttacgtt
gaaaacagacctaaatatgctggatatagctttgagaaactcttccctgatgtccttttc
ccagctgactcagaacacaacaaacttaaagccagtcaggcaagggatttgttatccaaa
atgctggtaatagatgcatctaaaaggatctctgtagatgaagctctccaacacccgtac
atcaatgtctggtatgatccttctgaagcagaagctccaccaccaaagatccctgacaag
cagttagatgaaagggaacacacaatagaagagtggaaagaattgatatataaggaagtt
atggacttggaggagagaaccaagaatggagttatacgggggcagccctctcctttaggt
gcagcagtgatcaatggctctcagcatccatcgtcatcgtcgtctgtcaatgatgtgtct
tcaatgtcaacagatccgactttggcctctgatacagacagcagtctagaagcatcagct
gggcctctgggctgctgtagatga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101133141
Entry
101133141         CDS       T02442                                 

Gene name
MAPK10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04024  cAMP signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04137  Mitophagy - animal
ggo04140  Autophagy - animal
ggo04141  Protein processing in endoplasmic reticulum
ggo04210  Apoptosis
ggo04215  Apoptosis - multiple species
ggo04217  Necroptosis
ggo04310  Wnt signaling pathway
ggo04380  Osteoclast differentiation
ggo04510  Focal adhesion
ggo04530  Tight junction
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04722  Neurotrophin signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04728  Dopaminergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04910  Insulin signaling pathway
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04917  Prolactin signaling pathway
ggo04920  Adipocytokine signaling pathway
ggo04926  Relaxin signaling pathway
ggo04930  Type II diabetes mellitus
ggo04931  Insulin resistance
ggo04932  Non-alcoholic fatty liver disease
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04935  Growth hormone synthesis, secretion and action
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05016  Huntington disease
ggo05017  Spinocerebellar ataxia
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05135  Yersinia infection
ggo05142  Chagas disease
ggo05145  Toxoplasmosis
ggo05152  Tuberculosis
ggo05161  Hepatitis B
ggo05162  Measles
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05171  Coronavirus disease - COVID-19
ggo05200  Pathways in cancer
ggo05210  Colorectal cancer
ggo05212  Pancreatic cancer
ggo05231  Choline metabolism in cancer
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101133141 (MAPK10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101133141 (MAPK10)
   04012 ErbB signaling pathway
    101133141 (MAPK10)
   04014 Ras signaling pathway
    101133141 (MAPK10)
   04310 Wnt signaling pathway
    101133141 (MAPK10)
   04668 TNF signaling pathway
    101133141 (MAPK10)
   04068 FoxO signaling pathway
    101133141 (MAPK10)
   04071 Sphingolipid signaling pathway
    101133141 (MAPK10)
   04024 cAMP signaling pathway
    101133141 (MAPK10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101133141 (MAPK10)
   04137 Mitophagy - animal
    101133141 (MAPK10)
  09143 Cell growth and death
   04210 Apoptosis
    101133141 (MAPK10)
   04215 Apoptosis - multiple species
    101133141 (MAPK10)
   04217 Necroptosis
    101133141 (MAPK10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101133141 (MAPK10)
   04530 Tight junction
    101133141 (MAPK10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101133141 (MAPK10)
   04621 NOD-like receptor signaling pathway
    101133141 (MAPK10)
   04622 RIG-I-like receptor signaling pathway
    101133141 (MAPK10)
   04625 C-type lectin receptor signaling pathway
    101133141 (MAPK10)
   04660 T cell receptor signaling pathway
    101133141 (MAPK10)
   04658 Th1 and Th2 cell differentiation
    101133141 (MAPK10)
   04659 Th17 cell differentiation
    101133141 (MAPK10)
   04657 IL-17 signaling pathway
    101133141 (MAPK10)
   04664 Fc epsilon RI signaling pathway
    101133141 (MAPK10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101133141 (MAPK10)
   04920 Adipocytokine signaling pathway
    101133141 (MAPK10)
   04912 GnRH signaling pathway
    101133141 (MAPK10)
   04914 Progesterone-mediated oocyte maturation
    101133141 (MAPK10)
   04917 Prolactin signaling pathway
    101133141 (MAPK10)
   04926 Relaxin signaling pathway
    101133141 (MAPK10)
   04935 Growth hormone synthesis, secretion and action
    101133141 (MAPK10)
  09156 Nervous system
   04728 Dopaminergic synapse
    101133141 (MAPK10)
   04723 Retrograde endocannabinoid signaling
    101133141 (MAPK10)
   04722 Neurotrophin signaling pathway
    101133141 (MAPK10)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101133141 (MAPK10)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101133141 (MAPK10)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101133141 (MAPK10)
   05231 Choline metabolism in cancer
    101133141 (MAPK10)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101133141 (MAPK10)
   05212 Pancreatic cancer
    101133141 (MAPK10)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101133141 (MAPK10)
   05012 Parkinson disease
    101133141 (MAPK10)
   05016 Huntington disease
    101133141 (MAPK10)
   05017 Spinocerebellar ataxia
    101133141 (MAPK10)
   05020 Prion disease
    101133141 (MAPK10)
   05022 Pathways of neurodegeneration - multiple diseases
    101133141 (MAPK10)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101133141 (MAPK10)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101133141 (MAPK10)
   04932 Non-alcoholic fatty liver disease
    101133141 (MAPK10)
   04931 Insulin resistance
    101133141 (MAPK10)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101133141 (MAPK10)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101133141 (MAPK10)
   05135 Yersinia infection
    101133141 (MAPK10)
   05133 Pertussis
    101133141 (MAPK10)
   05152 Tuberculosis
    101133141 (MAPK10)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101133141 (MAPK10)
   05170 Human immunodeficiency virus 1 infection
    101133141 (MAPK10)
   05161 Hepatitis B
    101133141 (MAPK10)
   05171 Coronavirus disease - COVID-19
    101133141 (MAPK10)
   05162 Measles
    101133141 (MAPK10)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101133141 (MAPK10)
   05169 Epstein-Barr virus infection
    101133141 (MAPK10)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101133141 (MAPK10)
   05142 Chagas disease
    101133141 (MAPK10)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101133141 (MAPK10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101133141 (MAPK10)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101133141 (MAPK10)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101133141 (MAPK10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 101133141
NCBI-ProteinID: XP_018881065
LinkDB
Position
4
AA seq 464 aa
MSLHFLYYCSEPTLDVKIAFCQGFDKQVDVSYIAKHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAAYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKTLEDFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPCPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDSLFPADSEHNKLKASQARDLLSKMLVIDPAKRISVDDALQHPYIN
VWYDPAEVEAPPPQIYDKQLDEREHTIEEWKELIYKEVMNSEEKTKNGVVKGQPSPSGAA
VNSSESLPPSSSVNDISSMSTDQTLASDTDSSLEASAGPLGCCR
NT seq 1395 nt   +upstreamnt  +downstreamnt
atgagcctccatttcttatactactgcagtgaaccaacattggatgtgaaaattgccttt
tgtcagggattcgataaacaagtggatgtgtcatatattgccaaacattacaacatgagc
aaaagcaaagttgacaaccagttctacagtgtggaagtgggagactcaaccttcacagtt
ctcaagcgctaccagaatctaaagcctattggctctggggctcagggcatagtttgtgcc
gcgtatgatgctgtccttgacagaaatgtggccattaagaagctcagcagaccctttcag
aaccaaacacatgccaagagagcgtaccgggagctggtcctcatgaagtgtgtgaaccat
aaaaacattattagtttattaaatgtcttcacaccccagaaaacgctggaggacttccaa
gatgtttacttagtaatggaactgatggatgccaacttatgtcaagtgattcagatggaa
ttagaccatgagcgaatgtcttacctgctgtaccaaatgttgtgtggcattaagcacctc
cattctgctggaattattcacagggatttaaaaccaagtaacattgtagtcaagtctgat
tgcacattgaaaatcctggactttggactggccaggacagcaggcacaagcttcatgatg
actccatatgtggtgacacgttattacagagcccctgaggtcatcctggggatgggctac
aaggagaacgtggatatatggtctgtgggatgcattatgggagaaatggttcgccacaaa
atcctctttccaggaagggactatattgaccagtggaataaggtaattgaacaactagga
acaccatgtccagaattcatgaagaaattgcaacccacagtaagaaactatgtggagaat
cggcccaagtatgcgggactcaccttccccaaactcttcccagattccctcttcccagcg
gactccgagcacaataaactcaaagccagccaagccagggacttgttgtcaaagatgcta
gtgattgacccagcaaaaagaatatcagtggacgacgccttacagcatccctacatcaac
gtctggtatgacccagccgaagtggaggcgcctccacctcagatatatgacaagcagttg
gatgaaagagaacacacaatcgaagaatggaaagaacttatctacaaggaagtaatgaat
tcagaagaaaagactaaaaatggtgtagtaaaaggacagccttctccttcaggtgcagca
gtgaacagcagtgagagtctccctccatcctcgtctgtcaatgacatctcctccatgtcc
accgaccagaccctggcatctgacactgacagcagcctggaagcctcggcaggacccctg
ggttgttgcaggtga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101152026
Entry
101152026         CDS       T02442                                 

Gene name
MAPK9
Definition
(RefSeq) mitogen-activated protein kinase 9 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04024  cAMP signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04137  Mitophagy - animal
ggo04140  Autophagy - animal
ggo04141  Protein processing in endoplasmic reticulum
ggo04210  Apoptosis
ggo04215  Apoptosis - multiple species
ggo04217  Necroptosis
ggo04310  Wnt signaling pathway
ggo04380  Osteoclast differentiation
ggo04510  Focal adhesion
ggo04530  Tight junction
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04722  Neurotrophin signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04728  Dopaminergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04910  Insulin signaling pathway
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04917  Prolactin signaling pathway
ggo04920  Adipocytokine signaling pathway
ggo04926  Relaxin signaling pathway
ggo04930  Type II diabetes mellitus
ggo04931  Insulin resistance
ggo04932  Non-alcoholic fatty liver disease
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04935  Growth hormone synthesis, secretion and action
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05016  Huntington disease
ggo05017  Spinocerebellar ataxia
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05135  Yersinia infection
ggo05142  Chagas disease
ggo05145  Toxoplasmosis
ggo05152  Tuberculosis
ggo05161  Hepatitis B
ggo05162  Measles
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05171  Coronavirus disease - COVID-19
ggo05200  Pathways in cancer
ggo05210  Colorectal cancer
ggo05212  Pancreatic cancer
ggo05231  Choline metabolism in cancer
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101152026 (MAPK9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101152026 (MAPK9)
   04012 ErbB signaling pathway
    101152026 (MAPK9)
   04014 Ras signaling pathway
    101152026 (MAPK9)
   04310 Wnt signaling pathway
    101152026 (MAPK9)
   04668 TNF signaling pathway
    101152026 (MAPK9)
   04068 FoxO signaling pathway
    101152026 (MAPK9)
   04071 Sphingolipid signaling pathway
    101152026 (MAPK9)
   04024 cAMP signaling pathway
    101152026 (MAPK9)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101152026 (MAPK9)
   04137 Mitophagy - animal
    101152026 (MAPK9)
  09143 Cell growth and death
   04210 Apoptosis
    101152026 (MAPK9)
   04215 Apoptosis - multiple species
    101152026 (MAPK9)
   04217 Necroptosis
    101152026 (MAPK9)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101152026 (MAPK9)
   04530 Tight junction
    101152026 (MAPK9)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101152026 (MAPK9)
   04621 NOD-like receptor signaling pathway
    101152026 (MAPK9)
   04622 RIG-I-like receptor signaling pathway
    101152026 (MAPK9)
   04625 C-type lectin receptor signaling pathway
    101152026 (MAPK9)
   04660 T cell receptor signaling pathway
    101152026 (MAPK9)
   04658 Th1 and Th2 cell differentiation
    101152026 (MAPK9)
   04659 Th17 cell differentiation
    101152026 (MAPK9)
   04657 IL-17 signaling pathway
    101152026 (MAPK9)
   04664 Fc epsilon RI signaling pathway
    101152026 (MAPK9)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101152026 (MAPK9)
   04920 Adipocytokine signaling pathway
    101152026 (MAPK9)
   04912 GnRH signaling pathway
    101152026 (MAPK9)
   04914 Progesterone-mediated oocyte maturation
    101152026 (MAPK9)
   04917 Prolactin signaling pathway
    101152026 (MAPK9)
   04926 Relaxin signaling pathway
    101152026 (MAPK9)
   04935 Growth hormone synthesis, secretion and action
    101152026 (MAPK9)
  09156 Nervous system
   04728 Dopaminergic synapse
    101152026 (MAPK9)
   04723 Retrograde endocannabinoid signaling
    101152026 (MAPK9)
   04722 Neurotrophin signaling pathway
    101152026 (MAPK9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101152026 (MAPK9)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101152026 (MAPK9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101152026 (MAPK9)
   05231 Choline metabolism in cancer
    101152026 (MAPK9)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101152026 (MAPK9)
   05212 Pancreatic cancer
    101152026 (MAPK9)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101152026 (MAPK9)
   05012 Parkinson disease
    101152026 (MAPK9)
   05016 Huntington disease
    101152026 (MAPK9)
   05017 Spinocerebellar ataxia
    101152026 (MAPK9)
   05020 Prion disease
    101152026 (MAPK9)
   05022 Pathways of neurodegeneration - multiple diseases
    101152026 (MAPK9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101152026 (MAPK9)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101152026 (MAPK9)
   04932 Non-alcoholic fatty liver disease
    101152026 (MAPK9)
   04931 Insulin resistance
    101152026 (MAPK9)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101152026 (MAPK9)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101152026 (MAPK9)
   05135 Yersinia infection
    101152026 (MAPK9)
   05133 Pertussis
    101152026 (MAPK9)
   05152 Tuberculosis
    101152026 (MAPK9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101152026 (MAPK9)
   05170 Human immunodeficiency virus 1 infection
    101152026 (MAPK9)
   05161 Hepatitis B
    101152026 (MAPK9)
   05171 Coronavirus disease - COVID-19
    101152026 (MAPK9)
   05162 Measles
    101152026 (MAPK9)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101152026 (MAPK9)
   05169 Epstein-Barr virus infection
    101152026 (MAPK9)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101152026 (MAPK9)
   05142 Chagas disease
    101152026 (MAPK9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101152026 (MAPK9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101152026 (MAPK9)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101152026 (MAPK9)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101152026 (MAPK9)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 101152026
NCBI-ProteinID: XP_004043192
Ensembl: ENSGGOG00000016519
UniProt: G3S624
LinkDB
Position
5
AA seq 424 aa
MSDSKCDSQFYSVQVADSTFTVLKRYQQLKPIGSGAQGIVCAAFDTVLGINVAVKKLSRP
FQNQTHAKRAYRELVLLKCVNHKNIISLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIH
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNF
MMTPYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGELVKGCVIFQGTDHIDQWNKVIEQ
LGTPSAEFMKKLQPTVRNYVENRPKYPGIKFEELFPDWIFPSESERDKIKTSQARDLLSK
MLVIDPDKRISVDEALRHPYITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEV
MDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPL
EGCR
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgagtgacagtaaatgtgacagtcagttttacagtgtgcaagtggcagactcaaccttc
actgtcctaaaacgttaccagcagctgaaaccaattggctctggggcccaagggattgtt
tgtgctgcatttgatacagttcttgggataaatgttgcagtcaagaaactaagccgtcct
tttcagaaccaaactcatgcaaagagagcttatcgtgaactcgtcctcttaaaatgtgtc
aatcataaaaatataattagtttgttaaatgtgtttacaccacaaaaaactctagaagaa
tttcaagatgtgtatttggttatggaattaatggatgctaacttatgtcaggttattcac
atggagctggatcatgaaagaatgtcctaccttctttaccagatgctttgtggtattaaa
catctgcattcagctggtataattcatagagatttgaagcctagcaacattgttgtgaaa
tcagactgcaccctgaagatccttgactttggcctggcccggacagcgtgcactaacttc
atgatgaccccttacgtggtgacacggtactaccgggcgcccgaagtcatcctgggtatg
ggctacaaagagaacgttgatatctggtcagtgggttgcatcatgggagagctggtgaaa
ggttgtgtgatattccaaggcactgaccatattgatcagtggaataaagttattgagcag
ctgggaacaccatcagcagagttcatgaagaaacttcagccaactgtgaggaattatgtc
gaaaacagaccaaagtatcctggaatcaaattcgaagaactctttccagattggatattc
ccatcagaatctgagcgagacaaaataaaaacaagtcaagccagagatctgttatcaaaa
atgttagtgattgatcctgacaagcggatctctgtagacgaagctctgcgtcacccatac
atcactgtttggtatgaccccgccgaagcagaagccccaccacctcaaatttatgatgcc
cagttggaagaaagagaacatgcaattgaagaatggaaagagctaatttacaaagaagtc
atggattgggaagaaagaagcaagaatggtgttgtaaaagatcagccttcagatgcagca
gtaagtagcaacgccactccttctcagtcttcatcgatcaatgacatttcatccatgtcc
actgagcagacgctggcctcagacacagacagcagtcttgatgcctcgacgggacccctt
gaaggctgtcgatga

DBGET integrated database retrieval system