KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124208Help
Entry
101124208         CDS       T02442                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00020  Citrate cycle (TCA cycle)
ggo00190  Oxidative phosphorylation
ggo01100  Metabolic pathways
ggo01200  Carbon metabolism
ggo04714  Thermogenesis
ggo04932  Non-alcoholic fatty liver disease (NAFLD)
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05016  Huntington disease
Module
ggo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ggo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ggo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101124208
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101124208
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101124208
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101124208
   05012 Parkinson disease
    101124208
   05016 Huntington disease
    101124208
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101124208
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101124208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Succ_DH_flav_C
Motif
Other DBs
NCBI-GeneID: 101124208
NCBI-ProteinID: XP_018869166
LinkDB All DBs
Position
17
AA seq 246 aa AA seqDB search
MGQGPQPPTPLPLLEDLRLQPHHQQGSAQLLLVCITTGLLACVTFTTRPRVRSPARGVGR
QRCLVGRGAVWNMVPHRQSAWSPGPWLYPAGKDVCGSEMFNAKSCCRVRVGSVLQEGCGK
ISKLYGDLKHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYK
VRIDEYDYSKPIQGQQKKPFEEHWRKHTLSYVDVGTGKVTLGYRPVIDKTLNEADCATVP
PAIRSY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgggccaagggccccagccacccacgcccctccctctccttgaagacctgcggctccaa
ccccaccatcagcagggctctgctcagctcctcctagtgtgtatcaccacagggctgctg
gcttgtgtcacgttcaccaccagaccccgcgtcaggagtcccgccaggggtgtggggagg
cagcgctgcctggttggccgtggagctgtatggaacatggtgcctcacaggcagtctgct
tggagtcctggaccctggctgtatcccgctggaaaggatgtgtgtgggtctgagatgttc
aatgcaaaatcatgctgccgtgttcgtgtgggaagcgtgttgcaagaaggttgtgggaaa
atcagcaagctctatggagacctaaagcacctgaagacgttcgaccggggaatggtctgg
aacacggacctggtggagaccctggagctgcagaacctgatgctgtgtgcgctgcagacc
atctacggagcagaggcgcggaaggagtcacggggcgcgcacgccagggaagactacaag
gtgcggattgatgagtacgattactccaagcccatccaggggcaacagaagaagcccttt
gaggagcactggaggaagcacaccctgtcctatgtggacgttggcactgggaaggtcacc
ctgggatatagacccgtaatcgacaaaactttgaacgaggctgactgtgccaccgtcccc
ccagccattcgttcctactga

DBGET integrated database retrieval system