KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124339
Entry
101124339         CDS       T02442                                 

Gene name
MAP2K7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7 isoform X4
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04141  Protein processing in endoplasmic reticulum
ggo04380  Osteoclast differentiation
ggo04530  Tight junction
ggo04620  Toll-like receptor signaling pathway
ggo04660  T cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04722  Neurotrophin signaling pathway
ggo04912  GnRH signaling pathway
ggo04926  Relaxin signaling pathway
ggo05010  Alzheimer disease
ggo05016  Huntington disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05132  Salmonella infection
ggo05135  Yersinia infection
ggo05161  Hepatitis B
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101124339 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101124339 (MAP2K7)
   04012 ErbB signaling pathway
    101124339 (MAP2K7)
   04668 TNF signaling pathway
    101124339 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101124339 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101124339 (MAP2K7)
   04660 T cell receptor signaling pathway
    101124339 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    101124339 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101124339 (MAP2K7)
   04926 Relaxin signaling pathway
    101124339 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101124339 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101124339 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101124339 (MAP2K7)
   05016 Huntington disease
    101124339 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    101124339 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101124339 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101124339 (MAP2K7)
   05135 Yersinia infection
    101124339 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101124339 (MAP2K7)
   05161 Hepatitis B
    101124339 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101124339 (MAP2K7)
   05169 Epstein-Barr virus infection
    101124339 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101124339 (MAP2K7)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101124339 (MAP2K7)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: STE group
  STE7 family
   101124339 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101124339
NCBI-ProteinID: XP_004059952
Ensembl: ENSGGOG00000012376
UniProt: G3R9J9
LinkDB
Position
19
AA seq 419 aa
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPTLQLPLANDGGSRSPSSES
SPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTGYLTIGGQRYQAEINDL
ENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRILMDLDVVLKSHDCPYIV
QCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTVAIVKALYYLKEKHGVI
HRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYMAPERIDPPDPTKPDYD
IRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLPGHMGFSGDFQSFVKDC
LTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESPRTSGVLSQPHLPFFR
NT seq 1260 nt   +upstreamnt  +downstreamnt
atggcggcgtcctccctggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgggaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccaccctgcagctcccgctggccaacgatgggggcagccgctcgccatcctcagagagc
tccccgcagcaccccacgccccccgcccggccccgccacatgctggggctcccgtcaacc
ctgttcacaccccgcagcatggagagcattgagattgaccagaagctgcaggagatcatg
aagcagacgggctacctgaccatcgggggccagcgctaccaggcagaaatcaacgacctg
gagaacttgggcgagatgggcagcggcacctgcggccaggtgtggaagatgcgcttccgg
aagaccggccacgtcattgccgttaagcaaatgcggcgctcggggaacaaggaggagaac
aagcgcatcctcatggacctggatgtggtgctcaagagccacgactgcccctacatcgtg
cagtgctttgggacgttcatcaccaacacggacgtcttcatcgccatggagctcatgggc
acctgcgctgaaaagctcaagaagcggatgcagggccccatccccgagcgcattctgggc
aagatgacagtggcgattgtgaaggcgctgtactacctgaaggagaagcacggtgtcatc
caccgcgacgtcaagccctccaacatcctgctggacgagcggggccagatcaagctctgc
gacttcggcatcagcggccgcctggtggactccaaagccaagacgcggagcgccggctgc
gccgcctacatggcacccgagcgcattgaccccccggaccccaccaagccggactatgac
atccgggccgacgtatggagcctgggcatctcgttggtggagctggcaacaggacagttt
ccctacaagaactgcaagacggactttgaggtcctcaccaaagtcctacaggaagagccc
ccgcttctgcccggacacatgggcttctcgggggacttccagtccttcgtcaaagactgc
cttactaaagatcacaggaagagaccaaagtataataagctacttgaacacagcttcatc
aagcgctacgagacgctggaggtggacgtggcgtcctggttcaaggatgtcatggcgaag
actgagtcaccgcggactagcggcgtcctgagccagccccacctgcccttcttcaggtag

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101143954
Entry
101143954         CDS       T02442                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4 isoform X1
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04620  Toll-like receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04912  GnRH signaling pathway
ggo04926  Relaxin signaling pathway
ggo04935  Growth hormone synthesis, secretion and action
ggo05132  Salmonella infection
ggo05135  Yersinia infection
ggo05142  Chagas disease
ggo05161  Hepatitis B
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101143954 (MAP2K4)
   04012 ErbB signaling pathway
    101143954 (MAP2K4)
   04668 TNF signaling pathway
    101143954 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101143954 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    101143954 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101143954 (MAP2K4)
   04926 Relaxin signaling pathway
    101143954 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    101143954 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101143954 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101143954 (MAP2K4)
   05135 Yersinia infection
    101143954 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101143954 (MAP2K4)
   05161 Hepatitis B
    101143954 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101143954 (MAP2K4)
   05169 Epstein-Barr virus infection
    101143954 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101143954 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101143954 (MAP2K4)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101143954 (MAP2K4)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: STE group
  STE7 family
   101143954 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101143954
NCBI-ProteinID: XP_018868961
Ensembl: ENSGGOG00000011958
UniProt: A0A2I2YYX3
LinkDB
Position
17
AA seq 400 aa
MAAPSPSGGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARF
TLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKM
VHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICME
LMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDR
SGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYE
LATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYK
ELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggcggctccgggggcggcagcggcagcggc
acccccggccccgtagggtccccggcgccaggccacccggccgtcagcagcatgcagggt
aaacgcaaagcactgaagttgaattttgcaaatccacctttcaaatctacagcaaggttt
actctgaatcccaatcctacaggagttcaaaacccacacatagagagactgagaacacac
agcattgagtcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgca
gaggacttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatg
gtccacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggatgaa
aaagaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgccca
tacattgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggaa
ctcatgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgtt
attccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccactta
aaagaaaacttgaaaattattcacagagatatcaaaccttccaatattcttctggacaga
agtggaaatattaagctctgtgacttcggcatcagtggacagcttgtggactctattgcc
aagacaagagatgctggctgtaggccatacatggcacctgaaagaatagacccaagcgct
tcacgacaaggatatgatgtccgctctgatgtctggagtttggggatcacattgtatgag
ttggccacaggccgatttccttatccaaaatggaatagtgtatttgatcaactaacacaa
gtcgtgaaaggagatcctccgcagctgagtaattctgaggaaagggaattctccccgagt
ttcatcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaa
gagcttctgaaacatccctttattttgatgtatgaagaacgtgccgttgaggtcgcatgc
tatgtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtcgat
tga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101154090
Entry
101154090         CDS       T02442                                 

Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04620  Toll-like receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04912  GnRH signaling pathway
ggo04926  Relaxin signaling pathway
ggo04935  Growth hormone synthesis, secretion and action
ggo05132  Salmonella infection
ggo05135  Yersinia infection
ggo05142  Chagas disease
ggo05161  Hepatitis B
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101154090
   04012 ErbB signaling pathway
    101154090
   04668 TNF signaling pathway
    101154090
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101154090
   04664 Fc epsilon RI signaling pathway
    101154090
  09152 Endocrine system
   04912 GnRH signaling pathway
    101154090
   04926 Relaxin signaling pathway
    101154090
   04935 Growth hormone synthesis, secretion and action
    101154090
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101154090
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101154090
   05135 Yersinia infection
    101154090
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101154090
   05161 Hepatitis B
    101154090
   05167 Kaposi sarcoma-associated herpesvirus infection
    101154090
   05169 Epstein-Barr virus infection
    101154090
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101154090
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101154090
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101154090
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: STE group
  STE7 family
   101154090
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 101154090
NCBI-ProteinID: XP_004043878
Ensembl: ENSGGOG00000025210
UniProt: A0A2I2YYX3
LinkDB
Position
6
AA seq 400 aa
MAAPSPSGGGGGSGGGSGSGTPGPVGSPAPGHPAVSSMQGKRKALKLNFANPPFKSTARF
TLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRGAYGSVNKM
VHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFREGDCWICME
LMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIKPSNILLDR
SGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVWSLGITLYE
LATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKDESKRPKYK
ELLKHPFILMYEERAVEVACYVCKILDQMPATPSSPMYVD
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggcggctccgggggcggcagcggcagcggc
acccccggccccgtagggtccccggcgccaggccacccggccgtcagcagcatgcagggt
aaacgcaaagcactgaagttgaattttgcaaatccacctttcaaatctacagcaaggttt
actctgaatcccaatcctacaggagttcaaaacccacacatagagagactgagaacacac
agcattgagtcatcaggaaaactgaagatctcccctgaacaacactgggatttcactgca
gaggacttgaaagaccttggagaaattggacgaggagcttatggttctgtcaacaaaatg
gtccacaaaccaagtgggcaaataatggcagttaaaagaattcggtcaacagtggatgaa
aaagaacaaaaacaacttcttatggatttggatgtagtaatgcggagtagtgattgccca
tacattgttcagttttatggtgcactcttcagagagggtgactgttggatctgtatggaa
ctcatgtctacctcgtttgataagttttacaaatatgtatatagtgtattagatgatgtt
attccagaagaaattttaggcaaaatcactttagcaactgtgaaagcactaaaccactta
aaagaaaacttgaaaattattcacagagatatcaaaccttccaatattcttctggacaga
agtggaaatattaagctctgtgacttcggcatcagtggacagcttgtggactctattgcc
aagacaagagatgctggctgtaggccatacatggcacctgaaagaatagacccaagcgct
tcacgacaaggatatgatgtccgctctgatgtctggagtttggggatcacattgtatgag
ttggccacaggccgatttccttatccaaaatggaatagtgtatttgatcaactaacacaa
gtcgtgaaaggagatcctccgcagctgagtaattctgaggaaagggaattctccccgagt
ttcatcaactttgtcaacttgtgccttacgaaggatgaatccaaaaggccaaagtataaa
gagcttctgaaacatccctttattttgatgtatgaagaacgtgccgttgaggtcgcatgc
tatgtttgtaaaatcctggatcaaatgccagctactcccagctctcccatgtatgtcgat
tga

DBGET integrated database retrieval system