KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124427
Entry
101124427         CDS       T02442                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X2
  KO
K09850  Ras association domain-containing protein 1
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04014  Ras signaling pathway
ggo04390  Hippo signaling pathway
ggo04392  Hippo signaling pathway - multiple species
ggo05200  Pathways in cancer
ggo05206  MicroRNAs in cancer
ggo05219  Bladder cancer
ggo05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101124427 (RASSF1)
   04390 Hippo signaling pathway
    101124427 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    101124427 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101124427 (RASSF1)
   05206 MicroRNAs in cancer
    101124427 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    101124427 (RASSF1)
   05223 Non-small cell lung cancer
    101124427 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH DUF5111 Mst1_SARAH
Other DBs
NCBI-GeneID: 101124427
NCBI-ProteinID: XP_004034244
Ensembl: ENSGGOG00000007106
UniProt: A0A2I2Z5D9
LinkDB
Position
Unknown
AA seq 270 aa
MGEAEAPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLARRPRRDQDEPVEWETPDL
SQAEIEQKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARR
GPGRGTSVRRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAER
HGEVYLRKLLDDEQPLRLRLLAGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQR
EEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 813 nt   +upstreamnt  +downstreamnt
atgggcgaggcggaggcgccttctttcgaaatgacctggagcagcacgacgagcagtggc
tactgcagccaagaggactcggactcggagctcgagcagtacttcaccgcgcgaacctcg
ctagcgcgcaggccgcgccgggaccaggacgagcctgtggagtgggagacacctgacctt
tctcaagctgagattgagcagaagatcaaggagtacaatgcccagatcaacagcaacctc
ttcatgagcttgaacaaggacggttcttacacaggcttcatcaaggttcagctgaagctg
gtgcgccctgtctctgtgccctccagcaagaagccaccctccttgcaggatgcccggcgg
ggcccaggacggggcacaagcgtcaggcgccgcacttccttttacctgcccaaggatgct
gtcaagcacctgcatgtgctgtcacgcacaagggcacgtgaagtcattgaggccctgctg
cgaaagttcttggtggtggatgacccccgcaagtttgcgctctttgagcgcgctgagcgt
catggtgaagtgtacttgcggaagctgttggatgatgagcagcccctgcggctgcggctc
ctggcagggcccagtgacaaggccctgagcttcgtcctgaaggaaaatgactctggggag
gtgaactgggacgccttcagcatgcctgaactacataacttcctgcgtatcctgcagcgg
gaggaggaagagcacctccgccagatcctgcagaagtactcctattgccgccagaagatc
caagaggccctgcacgcctgcccccttgggtga

DBGET integrated database retrieval system