KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124677Help
Entry
101124677         CDS       T02442                                 

Gene name
SETD1B
Definition
(RefSeq) SET domain containing 1B
  KO
K11422  histone-lysine N-methyltransferase SETD1 [EC:2.1.1.43]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    101124677 (SETD1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ggo03036]
    101124677 (SETD1B)
Enzymes [BR:ggo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101124677 (SETD1B)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101124677 (SETD1B)
   HMT complexes
    COMPASS/SET1 complex
     101124677 (SETD1B)
    COMPASS/SET1 complex (yeast)
     101124677 (SETD1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: N-SET SET RRM_1 RRM_5
Motif
Other DBs
NCBI-GeneID: 101124677
NCBI-ProteinID: XP_018893466
Ensembl: ENSGGOG00000006715
LinkDB All DBs
Position
12
AA seq 2044 aa AA seqDB search
MVPTWTPAFCPPSRCQRRRAPEPREAGFGVRNPHDRKESSDLGRARGRRQAAPRTPEGRC
EARLLALGAEEAQGSEEPFLSSGEGVAGRRRKPERRYLDCNSSESTPASPAAPSVHTHPR
PPRPQPSPRVPARPPPARAVGKQFCRPGTHAAAVAALRTGAPALEFDKCLEKGVCPWGGG
PALSSRPPNFSPQMSSNRPVEIVEDPRVVGIWTKNKELELSVPKFKIDEFYVGPVPPKQV
TFAKLNDNIRENFLRDMCKKYGEVEEVEILYNPKTKKHLGIAKVVFATVRGAKDAVQHLH
STSVMGNIIHVELDTKGETRMRFYELLVTGRYTPQTLPVGELDAVSPIVNETLQLSDALK
RLKDGGLSAGCGSGSSSVTPNSGGTPFSQDTAYSSCRLDTPNSYGQGTPLTPRLGTPFSQ
DSSYSSRQPTPSYLFSQDPAVTFKARRHESKFTDAYNRRHEHHYVHNSPAVTAVAGAAAA
FRGSSDLPFGAVGSTGGSSGPPFKAQPQDSATFAHTPPPAQATPAPGFKSAFSPYQTPVA
HFPPPPEEPTATAAFGARDSGEFRRAPAPPPLPPAEPLAKEKPGTPPGPPPPDTNSMELG
GRPTFGWSPEPCDSPGTPTLESSPAGPEKPHDSLDSRIEMLLKQQRTKLLFLREPDSDTE
LQMEGSPISSSSSQLSPLAPFGTNSQPGFRGPTPPSSRPSSTGLEDISPTPLPDSDEDEE
LDLGLGPRPPPEPGPPDPAGLLGQTAEVALDLVGDRTPTSEKMDEGQQSSGEDMEISDDE
MPSAPITSADCPKPMVVTPGAAAVAAPSVLAPTLPLPPPPGFPPLPPPPPPPPPQPGFPM
PPPLPPPPPPPPPAHPAVTVPPPPLPAPPGVPPPPILPPLPPFPPGLFPVMQVDMSHVLG
GQWGGMPMSFQMQTQVLSRLMTGQGACPYPPFMAAAAAAASAGLQFVNLPPYRGPFSLSN
SGPGRGQHWPPLPKFDPSVPPPGYMPRQEDPHKATVDGVLLVVLKELKAIMKRDLNRKMV
EVVAFRAFDEWWDKKERMAKASLTPVKSGEHKDEDRPKPKDRIASCLLESWGKGEGLGYE
GLGLGIGLRGAIRLPSFKVKRKEPPDTTSSGDQKRLRPSTSVDEEDEESERERDRDMADT
PCELAKRDPKGVGVRRRPARPLELDSGGEEDEKESLSASSSSSASSSSGSSTTSPSSSAS
DKEEEQESTEEEEEAEEEEEVPRSQLSSSSTSSTSDKDDDDDDSDDRDESENDDEDTALS
EASEKGEGDSDEEETVSIVTSKAEATSSSESSESSEFESSSESSPSSSEDEEEVVAREEE
EEEEEEEMVAEESMASAGPEDFEQDGEEAALAPGAPAVDSLGMEEEVDIETEAVAPEERP
SMLDEPPLPVGVEEPADSREPPEEPGLSQEGAMLLSPEPPAREVEAQPPLSPERAPEHDL
EVEPEPPTMLPLPLQPPLPPPRPPRPPSPPPEPETTDAPHPSVPPEPPAEDHPPHTPGLC
GSLAKSQSTETVPATPGGEPPLSGGSSGLSLSSPQVPGSPFSYPAPSPSLSSGGLPRTPG
RDFSFTPTFSEPSGPLLLPVCPLPTGRRDERSGPLASPVLLETGLPLPLPLPLPLPLALP
AVLRAQARAPTPLPPLLPAPLASCPPPMKRKPGRPRRSPPSMLSLDGPPPPPPPPPVEPT
KLPFKELDNQWPSEVIPPGPRGRDEVTEEYMELAKSRGPWRRPPKKRHEDLVPPAGSPEL
SPPQPLFRPRSEFEEMTILYDIWNGGIDEEDIRFLCVTYERLLQQDNGMDWLNDTLWVYH
PSTSLSSAKKKKRDDGIREHVTGCARSEGFYTIDKKDKLRYLNSSRASTDEPPADTQGMS
IPAQPHASTRAGSERRSEQRRLLSSFTGSCDSDLLKFNQLKFRKKKLKFCKSHIHDWGLF
AMEPIAADEMVIEYVGQNIRQVIADMREKRYEDEGIGSSYMFRVDHDTIIDATKCGNFAR
FINHSCNPNCYAKVITVESQKKIVIYSKQHINVNEEITYDYKFPIEDVKIPCLCGSENCR
GTLN
NT seq 6135 nt NT seq  +upstreamnt  +downstreamnt
atggtgccaacatggacgccggccttttgtcctccttcgcgttgccagcgcaggcgcgcc
ccggagccccgagaagccggcttcggggtgcggaatcctcacgatcgaaaggaaagttca
gacctgggaagagcgagggggcgaaggcaggcggctccaaggacccccgagggtcgctgc
gaagcccgtcttctcgccctgggggcagaagaggcacaggggtccgaagagcccttcctc
agctccggggagggggtcgcgggccggaggaggaagccggagcgcagatacctcgattgc
aactcctctgagtcgacgccggcctcccccgcggctcccagcgtccacacacaccctcgg
ccccccagaccccagccatctccccgggtccccgcgcgcccgcctccggcccgggcagtt
gggaaacagttttgcaggcccgggacgcacgccgcggcggtcgcggctctgaggacgggg
gccccagccctggagtttgacaagtgcctggagaaaggggtctgcccatggggaggggga
ccagctctctcatcccggccccctaatttctccccacagatgtccagcaaccgcccggtg
gaaattgtcgaagatccccgggtcgtcgggatctggaccaaaaacaaggagctggagctg
tcggtgcccaaattcaagatcgatgagttctacgtgggcccggtgcctccgaagcaggtg
acatttgccaagctgaatgataacatccgtgaaaacttcctgagggacatgtgcaagaag
tatggggaggtggaggaggtggagattttgtacaaccccaagaccaagaagcacctgggc
atcgccaaggtggtctttgccacggtccggggagccaaggatgccgttcagcacttgcac
agcacttccgtcatgggcaacattatccacgtggagctggacaccaaaggggaaacccga
atgcggttctatgaactgttggtcactggccgatacaccccccagaccctcccagtgggc
gagctggatgctgtctctccaatcgtgaatgagaccctgcagctgtcagatgccctgaag
cgcctcaaggatggaggcctgtctgcaggctgtggctccggctcctcctctgtcaccccc
aatagcggtgggacacccttctcccaggacacagcttactccagctgccgcctggacaca
cccaactcctatggacagggcaccccgctcacaccgcgcctgggcacccctttctcacag
gactccagctactccagccgccagcccacaccctcatacctcttcagccaggaccccgca
gtgaccttcaaggcccggcgccacgagagcaagttcacggacgcctacaaccgccgccac
gaacatcattatgtacacaattctcccgcggtcactgcggtggccggggccgcagccgcc
ttccggggttcctcggacctcccgttcggagcagtcggcagcactgggggcagcagcggc
ccccccttcaaggctcaaccacaggattcagccacatttgcccacactccaccacccgcc
caagcaacccctgctcctggattcaagtctgctttctctccgtatcagaccccagtggcc
cacttccctccacccccagaagagcccactgccacagccgcctttggggcccgcgacagt
ggggagttccggagggcaccggcgcccccacccctgccacctgctgagcctctggccaag
gagaagccaggcacgccacccggcccgccgccccccgacaccaacagcatggagctgggc
ggccggcccaccttcggctggagtcctgagccctgtgacagccctggcacgcccacgctg
gagtcgtcccctgcagggccagagaaaccccacgacagcctggactcgcgcatcgagatg
ctgctgaagcagcagcgcaccaagctgctcttcctgcgggagccggactcggacactgag
ctgcagatggagggcagccccatctcctcctcctcctcccagctctccccactggccccc
tttggcaccaactcccagccaggcttccggggccccacgcccccctcgtcacgcccctcc
agcaccggcctggaggacatcagcccaacacccctgccagactccgacgaggatgaggag
ctcgacctgggccttgggcctcggcctccacctgagccaggccccccggaccctgctggg
cttctgggccagacagctgaggtggccttggacctggttggagacagaaccccgacctca
gagaagatggatgagggccagcagtcctcaggcgaggacatggagatctcggatgacgag
atgccctcggcccccatcaccagcgccgactgccccaagcccatggtggtgaccccagga
gcggcagccgtggcagccccttctgtgctagccccaaccctgccgctgcccccgccacct
ggcttccccccgctgccccccccaccaccaccacccccaccgcagcctggcttccccatg
cccccaccgctgcccccaccgccgcccccaccccctccagcccaccctgctgtgacagtg
cccccaccacccttgccagcgccacctggagtcccgcccccacccatcctgccaccactg
cccccctttccgccgggcctgttccctgtgatgcaggtggacatgagccacgtgctgggt
ggccagtggggcggcatgcccatgtccttccagatgcaaacgcaggtgctcagccggctg
atgacgggccagggcgcctgcccctatccacccttcatggctgctgcggccgccgctgcc
tcagctgggctccagtttgtcaacctgccgccctaccggggccccttctccctgagcaac
tccggcccaggccgcgggcagcactggccaccactgcccaagtttgacccgtcagtgcct
ccaccaggctacatgccacgccaggaggacccacacaaagccacggtggatggcgtcctg
ctggtggtcctcaaagaactcaaggccatcatgaagcgtgacctgaaccgcaagatggtg
gaagtggtggctttccgggcctttgacgagtggtgggacaagaaggagcggatggccaag
gcctcgctgaccccggtgaagtcgggcgagcacaaggatgaggacaggccgaagcccaag
gaccgcatcgcctcgtgcctgctggagtcatggggcaagggcgagggcctgggctacgag
ggcctgggcctgggcattgggctgcgtggggccattcgcctgccctccttcaaggtcaag
aggaaggagccaccagacaccacctcatctggcgaccagaagcggctgcggccctcgacc
tctgtggatgaggaagatgaagagtccgagcgagagcgagaccgggatatggcagacacc
ccctgtgagctcgccaagcgggaccccaagggcgtgggtgtgcggcggcggccggcgcgg
cctctggagctggacagtggtggggaggaggacgagaaggagtcgttgtcggcgtcctcg
tcctcatcggcatcatcatcctcggggtcctcaaccacctcaccctcgtcctcggcctcc
gacaaggaggaggaacaggagagcaccgaggaggaagaggaggcggaggaggaggaggaa
gtccccaggagccagctctcctcctcctcaacctcatccacatcagataaggatgacgac
gatgacgacagtgatgaccgggacgagtctgagaacgatgacgaggacacagccctgtca
gaggcgagtgagaagggcgaaggggactcggatgaagaggagacagtgagcattgtaacc
tccaaggccgaagccacgtcgtccagtgagagttccgagtcttctgagtttgagtcaagc
tccgagtcctcgccctcatcctcggaggatgaggaggaggtagtggccagggaagaggag
gaagaagaggaggaggaggagatggtggccgaggaaagcatggcttctgcaggccccgag
gactttgagcaggacggggaggaagcggctctggccccgggggcacctgcagtggactcg
ttgggcatggaagaggaggtggacatcgagactgaggctgtggcccctgaggagcggccc
tccatgctggacgagccccccttgcctgtgggtgttgaagagccagcggactccagggag
ccccccgaggaaccaggcctgagccaggaaggggccatgttgctgtctccggagccccct
gccagggaggtggaggctcaacccccattgtcccctgagcgagctccagaacatgacctg
gaagtggagccggagccccctacgatgctccccttgcccctgcaaccaccactgccgccc
ccacgaccaccccggccacccagcccaccgccggagcctgagaccacagatgccccacac
ccatctgtccctccggagccccctgccgaggaccaccccccacatactccaggcctctgt
ggcagcctggccaagtcgcagagcacagagacggtgccagccacaccaggcggggagccc
ccgctatcagggggcagcagtggcctgtccctgagctctccgcaagtgcccggcagcccc
ttctcctacccagccccgtcccctagcttgagcagtgggggcctccctcggacacctggc
cgggacttcagcttcacacccaccttctccgagcccagcgggcccttgctcctgcccgtc
tgcccactccccactggccgacgcgatgaacgctccgggcccctggcctccccggtgctc
ctggagacgggcctgcccctccctctgccccttcccctgcccttgcccttggcattgccc
gctgtcttgcgggcccaggctcgtgcccccaccccgctgccacccctgctgcccgccccc
ctggcctcttgcccacccccaatgaagaggaagccgggccggccccggcgatccccacca
tctatgctctccttggatgggccacccccacccccacctcccccacctgtagagcccacc
aagctgccctttaaggagctagacaaccagtggccctccgaggtcatccctccgggcccc
cgtgggcgcgatgaggtcactgaggagtacatggagttggccaagagccgggggccatgg
cgccggccacctaagaagcgccatgaggacctggtgccacctgcgggctcgcccgaactc
tcgccaccccagcccctcttccggccccgctcggagtttgaggagatgaccatcctgtat
gacatctggaacggtggcatcgacgaggaggacatccgcttcctgtgtgtcacctacgag
cgactgctacagcaggacaatggcatggactggcttaacgacacgctctgggtctaccat
ccctccaccagcctctcttcagctaagaagaagaaacgggacgatggcatccgcgagcac
gtgacgggctgtgcccgcagtgagggcttctacaccatcgacaagaaggacaagctcaga
tacctcaacagcagccgtgccagcaccgatgagccccccgcagacacccagggcatgagc
atcccagcacagccccacgcctccacccgggcaggctcggagcggcgttcggagcagcgc
cgcctgctgtcctccttcactggcagctgtgacagcgacctgctcaagttcaaccagctc
aagttccggaagaaaaagctcaagttctgcaagagccacattcacgactggggcttgttc
gccatggagcccatcgcggctgacgagatggtcatcgagtacgtgggccagaatatccgt
caggtgatcgcagacatgcgggagaagcgttatgaggacgagggcatcgggagcagctac
atgttccgggtggaccacgacaccatcatcgacgccaccaagtgcggcaacttcgcgcgc
ttcatcaaccacagctgcaaccccaactgctatgccaaggtgatcacggtggagtcacag
aagaagatagtcatctactcgaagcagcacattaacgtcaatgaggagattacctatgac
tataagttccccatcgaggacgtcaagatcccctgcctctgtggctctgagaactgccgg
gggaccctcaactag

DBGET integrated database retrieval system