KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124725
Entry
101124725         CDS       T02442                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3 isoform X6
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04114  Oocyte meiosis
ggo04210  Apoptosis
ggo04218  Cellular senescence
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04621  NOD-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04742  Taste transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05014  Amyotrophic lateral sclerosis
ggo05017  Spinocerebellar ataxia
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05163  Human cytomegalovirus infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101124725 (ITPR3)
   04020 Calcium signaling pathway
    101124725 (ITPR3)
   04070 Phosphatidylinositol signaling system
    101124725 (ITPR3)
   04022 cGMP-PKG signaling pathway
    101124725 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101124725 (ITPR3)
   04210 Apoptosis
    101124725 (ITPR3)
   04218 Cellular senescence
    101124725 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101124725 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101124725 (ITPR3)
   04621 NOD-like receptor signaling pathway
    101124725 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    101124725 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    101124725 (ITPR3)
   04922 Glucagon signaling pathway
    101124725 (ITPR3)
   04929 GnRH secretion
    101124725 (ITPR3)
   04912 GnRH signaling pathway
    101124725 (ITPR3)
   04915 Estrogen signaling pathway
    101124725 (ITPR3)
   04921 Oxytocin signaling pathway
    101124725 (ITPR3)
   04935 Growth hormone synthesis, secretion and action
    101124725 (ITPR3)
   04918 Thyroid hormone synthesis
    101124725 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    101124725 (ITPR3)
   04924 Renin secretion
    101124725 (ITPR3)
   04925 Aldosterone synthesis and secretion
    101124725 (ITPR3)
   04927 Cortisol synthesis and secretion
    101124725 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101124725 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    101124725 (ITPR3)
   04971 Gastric acid secretion
    101124725 (ITPR3)
   04972 Pancreatic secretion
    101124725 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101124725 (ITPR3)
   04725 Cholinergic synapse
    101124725 (ITPR3)
   04728 Dopaminergic synapse
    101124725 (ITPR3)
   04726 Serotonergic synapse
    101124725 (ITPR3)
   04720 Long-term potentiation
    101124725 (ITPR3)
   04730 Long-term depression
    101124725 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    101124725 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    101124725 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    101124725 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101124725 (ITPR3)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101124725 (ITPR3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101124725 (ITPR3)
   05012 Parkinson disease
    101124725 (ITPR3)
   05014 Amyotrophic lateral sclerosis
    101124725 (ITPR3)
   05017 Spinocerebellar ataxia
    101124725 (ITPR3)
   05020 Prion disease
    101124725 (ITPR3)
   05022 Pathways of neurodegeneration - multiple diseases
    101124725 (ITPR3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101124725 (ITPR3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101124725 (ITPR3)
   05163 Human cytomegalovirus infection
    101124725 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101124725 (ITPR3)
Protein phosphatases and associated proteins [BR:ggo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101124725 (ITPR3)
Ion channels [BR:ggo04040]
 Ligand-gated channels
  IP3 receptor
   101124725 (ITPR3)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 101124725
NCBI-ProteinID: XP_004043882
Ensembl: ENSGGOG00000016235
UniProt: G3RJI5
LinkDB
Position
6
AA seq 2671 aa
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYKGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGMGAQGRTGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDIEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLNEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFREKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIRTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFANTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQGPPA
MLQAYEDPGGKNVRQSIQGVGHMMSTMVLSRKQSVFSAPSLSAGASAAEPLDRSKFEENE
DIVVMETKLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTT
ANMNLDRIGEQAEAMFGVGKTSSMLEVDDEGGRMFLRVLIHLTMHDYAPLVSGALQLLFK
HFSQRQEAMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGSGKGEEVE
AGAAKDKKERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNM
DAHKVMLDLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLE
AETMQHIFLNNYQLCSEISEPVLQHFVHLLATHGRHVQYLDFLHTVIKAEGKYVKKCQDM
IMTELTNAGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKN
VYTEIKCTSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTL
FENFTLDMARVCSKREKRVADPTLEKYVLSVVLDTINAFFSSPFSENSTSLQTHQTIVVQ
LLQSTTRLLECPWLQQQHKGSVEACIRTLAMVAKGRAILLPMDLDAHISSMLSSGASCAA
AAQRNASSYKATTRAFPRVTPTANQWDYKNIIEKLQDIITALEERLKPLVQAELSVLVDV
LHWPELLFLEGSEAYQRCESGGFLSKLIQHTKDLMESEEKLCIKVLRTLQQMLLKKTKYG
DRGNQLRKMLLQNYLQNRKSTSRGDLLDPIGTGLDPDWSAIAATQCRLDKEGATKLVCDL
ITSTKNEKIFQESIGLAIHLLDGGNTEIQKSFHNLMMSDKKSERFFKVLHDRMKRAQQET
KSTVAVNMNDLGSQPREDREPVDPTTKGRVASFSIPGSSSRYLLGPSLRRGHEVSERVQS
SEMGTSVLIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTG
GLGLLGLYINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISP
LCKYRMDLVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERE
NSEVSPREVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLSQML
KSSVPAQEEEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTE
QDEQGSKVSDFFDQSSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIA
FFYPYMEGASTGVLDSPLISLLFWILICFSITALFTKRYSIRPLIVALILRSIYYLGIGP
TLNILGALNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELF
YSILLFDLIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVD
RLPNNHSTASPLGMPHGAAAFVDTCSGDKMDCVSGVSVPEVLEEDRELDSTERACDTLLM
CIVTVMNHGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTF
ADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFEEHIKLEHNMWNYLYFIVLVRVKNK
TDYTGPESYVAQMIKNKNLDWFPRMRAMSLVSNEGEGEQNEIRILQDKLNSTMKLVSHLT
AQLNELKEQMTEQRKRRQRLGFVDVQNCISR
NT seq 8016 nt   +upstreamnt  +downstreamnt
atgagtgaaatgtccagctttcttcacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggctggtggatgaccgctgtgtggtggagccc
gcggccggggacctggacaacccccctaagaagttccgagactgcctcttcaaggtgtgc
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagactaagcaggac
aaggagaagatcgctgacgtggtgttgctgcagaagctgcagcacgcggcacagatggag
cagaagcaaaacgacacggagaacaagaaggtgcacggggatgtcgtgaagtatggcagt
gtgatccagctcctgcacatgaagagcaacaagtacctgacagtgaacaagcggcttccg
gccttgctggagaagaacgccatgcgggtgactctggatgccacaggcaacgagggttcc
tggctcttcatccagcccttctggaagctgcggagcaacggagacaacgtggtcgtgggg
gacaaggtgatcctgaatcctgtcaatgccgggcagcctctgcatgccagcaattacgag
ctcagcgacaacgccggctgcaaggaggtcaactctgtgaactgcaacaccagctggaag
atcaacctgtttatgcagtttcgggaccacctggaggaggtgttgaaagggggagacgtg
gtgcggctgttccatgcagagcaggagaagttcctgacgtgtgacgagtacaagggcaag
ctgcaggtgttcctgcgaaccacactgcgccagtctgccacctcggccaccagctccaat
gctctctgggaggtggaggtggtccaccacgacccctgccgtggaggagctgggcactgg
aatggcctgtaccgcttcaagcacctggctacaggcaactacctggctgctgaggagaac
cccagttacaaaggtgatgcctcagatcccaaggcagcaggaatgggggcacagggccgc
acaggccgcaggaatgctggggagaagatcaagtaccgcctggtggctgtgcctcatggc
aatgacatcgcctctctctttgagctggaccccaccaccttgcagaaaaccgactctttc
gtgccccggaactcgtacgtccggctgcggcacctctgcaccaacacgtggattcagagc
accaatgtgcccattgacatcgaggaggagcggcccatccggctcatgctgggcacctgc
cccaccaaggaggacaaggaggcctttgccatcgtgtcagtgcccgtgtctgagatccga
gacctggactttgccaatgacgccagctccatgctggccagtgccgtggagaaactcaac
gagggcttcatcagccagaatgaccgcaggtttgtcatccagctgctggaagacctggtg
ttctttgtcagcgatgtccccaacaatgggcagaatgtcctggacatcatggtcactaag
cccaaccgggaacggcagaagctgatgagggagcagaacatcctcaaacagatctttggc
attctgaaggccccgttccgtgagaaggggggtgaaggtcccctggtgcggctggaggag
ctgtcagaccagaagaacgccccctaccagcacatgttccgcctgtgctaccgcgtgctg
cggcattcccaggaggactaccgcaagaaccaggagcacattgccaagcagtttgggatg
atgcagtcccagattggctacgacatcctggccgaggacaccatcactgccctgctgcac
aacaaccgcaagctcctggaaaagcacatcaccaagaccgaggtggagaccttcgtcagc
cttgtgcgcaagaaccgggagcccaggttcctggactacctctctgacctgtgtgtgtcc
aaccacatcgccatccccgtcacccaagagctcatctgcaagtgtgtgctggaccccaag
aacagtgacattctcatccggaccgagcttcggcccgtgaaggagatggcccaatcccac
gagtacctgagcatcgagtactcagaagaggaagtgtggctcacgtggactgacaagaat
aacgagcatcatgagaagagtgtgaggcagctggcccaggaggcgcgggccggcaacgcc
cacgacgagaatgtgctcagctactacaggtaccagctgaagctctttgcccgcatgtgc
ttggaccgccagtacttggccatcgatgagatctcccagcagctgggcgtggacctgatt
ttcctgtgcatggcagacgagatgctgccctttgacctgcgcgcctccttctgccacctg
atgctgcacgtgcacgtggaccgtgacccccaggagctggtcacgccggtcaagtttgcc
cgtctctggactgagatccccacagccatcactatcaaggactatgattccaacctcaac
gcgtcccgagatgacaagaagaacaagtttgccaacaccatggagttcgtggaggactac
ctcaacaatgtggtcagcgaggccgtgccctttgccaacgaggagaagaacaagctcact
tttgaggtggtcagcctggcgcacaatctcatctacttcggcttctacagcttcagcgag
ctgctgcggctcactcgcacactgctgggcatcatcgactgtgtgcaggggcccccggcc
atgctgcaggcctatgaggaccccggtggcaagaatgtgcggcagtccatccagggcgtg
gggcacatgatgtccaccatggtgctgagccgcaagcagtccgtcttcagtgcccccagc
ctgtctgctggggccagtgctgctgagccgctggacagaagcaagtttgaggagaatgag
gacattgtggtgatggagaccaagctgaagatcctggaaatccttcagttcatcctcaat
gtccgcctggattaccgcatatcctacctgctgtctgtcttcaagaaggagtttgtggag
gtgtttcccatgcaggacagcggggctgatggcacagcccctgccttcgactctaccact
gccaacatgaacctggatcgcatcggggagcaggcagaggccatgtttggagtggggaag
acaagcagcatgctggaggtggacgacgagggtggccgcatgttcctgcgcgtgctcatc
cacctcaccatgcacgactatgcgccactggtctcgggtgccctgcagctgctcttcaag
cacttcagccagcgccaggaggccatgcacaccttcaagcaggttcagctgctgatctca
gcgcaggacgtggagaactacaaggtgatcaagtcggagctggaccggctgcggaccatg
gtggagaagtcagagctgtgggtggacaagaagggcagcggcaagggcgaggaggtggag
gcaggcgctgccaaggacaagaaagagcgtcccacggacgaggagggctttctgcaccca
ccaggggagaaaagcagtgagaactaccagatcgtcaagggcatcctggaaaggctgaac
aagatgtgcggggtcggggagcaaatgaggaagaagcagcaacggctgctgaagaacatg
gatgcccacaaggtcatgctggacctgctgcaaatcccctacgacaagggtgatgccaag
atgatggagatcctgcgctacacgcaccagttcctgcagaagttctgtgcagggaacccc
ggcaaccaggccctgctgcacaagcacctgcacctcttcctcacgccggggctcctggag
gcagagaccatgcagcacatcttcctgaacaactatcagctctgctccgagatcagcgag
cctgtgttgcagcacttcgtgcacctgctggccacgcacgggcgccatgtgcagtacttg
gacttcctgcacaccgtcattaaggccgagggcaagtacgtcaagaagtgccaggacatg
atcatgactgagctgaccaatgcaggtgacgatgtggtcgtgttctacaatgataaggca
tcgctggcccacctgctggacatgatgaaggccgcccgcgacggcgtggaggaccacagc
cccctcatgtaccacatttccctggtggacctgctggccgcctgtgccgagggcaaaaac
gtctacactgagatcaagtgcacctccctgctgccgctggaggacgtggtgtctgtggtg
acgcatgaggactgcatcactgaggtgaaaatggcctatgtgaacttcgtgaaccactgc
tacgtggacactgaggtggagatgaaggagatctacaccagcaaccacatctggacgctc
ttcgagaacttcaccctggacatggctcgggtctgcagcaagcgtgagaagcgtgtggct
gaccccaccctggagaagtacgtgctgagcgttgtgctggacaccatcaacgccttcttc
agctccccattctctgagaacagcacttccctgcagacacaccagacgattgtggtgcag
ctgctgcagtctaccacacgcctcctcgagtgtccgtggctacagcagcagcacaagggc
tccgtggaggcctgcatccggaccctcgccatggtggccaagggccgggccatcttgttg
cccatggacctggatgcccacatcagctcgatgctcagcagtggagccagctgtgcagct
gccgcccagcggaacgcctccagctacaaggcaaccacgcgggccttcccccgcgtcacc
cccaccgccaaccagtgggactacaagaacatcattgagaagctgcaggacatcatcaca
gccctggaggagcggctgaagcccctggtacaggctgagctgtctgtgctggtggatgtc
ctgcactggcctgagctgctcttcctggagggcagtgaggcctaccagcgctgcgagagt
gggggcttcctgtccaagctgatccagcacaccaaggacctcatggagtcggaggagaag
ctgtgcatcaaggtgctgcggaccctgcagcagatgctgctcaagaagaccaagtacggg
gaccggggcaaccagctgcgcaagatgctgctgcaaaactacctccagaaccggaagtcc
acctcgcggggggaccttctcgaccccataggcactggcctggacccagactggtcggca
atcgcggccacccagtgccggctggacaaggagggggccaccaagttggtatgcgacctc
atcaccagcaccaagaacgagaagatcttccaggagagcatcggcctggccatccacctg
ctggatggtggcaacacagagatccagaaatccttccacaacctgatgatgagtgacaag
aagtcagagcgcttcttcaaggtgctgcacgaccgcatgaagcgggcccagcaggagacc
aagtccacggtggcagtcaacatgaatgacctgggcagccagccacgtgaggaccgcgag
ccagtcgaccccaccaccaaaggccgcgtggcctccttctcgatacctggctcctcatcc
cgctacttgctgggccccagcctgcgccgggggcacgaggtgagcgaacgtgtgcagagc
agtgagatgggcacatccgtgctcatcatgcagcccatcctgcgctttctgcagctgctg
tgtgagaaccacaaccgggacctgcagaacttcctgcgctgtcagaacaacaaaaccaac
tacaacttggtgtgcgagacgctgcagttcctggacatcatgtgcggcagcaccacgggc
ggcctggggctgctggggctctacatcaatgaggacaacgtgggcctcgtcatccagacc
ttggagaccctcactgagtactgccagggcccctgccatgagaaccagacttgcattgtg
actcatgagtccaatggcatagacatcatcaccgcactgatcctcaatgacatcagcccc
ctgtgcaagtaccgcatggatctggtgctgcagctcaaggacaatgcctccaagctgctc
ctggctctgatggagagccggcatgacagtgaaaatgctgagcgcatcctcatcagcctg
cggccccaggagctggtggacgtcatcaagaaggcctacctgcaggaggaagagcgtgag
aactcagaggtgagcccacgtgaagtgggccataacatctatatcctggcgctgcagctc
tccaggcacaataaacagctgcagcacctgctgaagccggtgaagcgcattcaagaggag
gaggccgagggtatctcttccatgctcagcctcaacaacaagcagctgtcacagatgctc
aagtcctcagtgccagcacaggaggaggaggaagaccccctggcctactacgagaaccac
acgtcccagatcgagattgtgcggcaggaccgcagcatggagcagatcgtgttcccagtg
cccggcatctgccagttcctgacggaggaaaccaagcaccggctcttcaccactactgag
caggacgagcagggcagcaaagtgagcgacttcttcgaccagtcctccttcctgcacaac
gagatggagtggcagcgcaagctccgcagcatgccgctgatctactggttctcccgccgc
atgaccctgtggggcagcatctccttcaacctggccgtgtttatcaacatcatcattgcc
ttcttctacccttacatggagggtgcgtccacaggcgtgctggactcccctctcatctca
ttgctcttctggatcctcatctgcttctccatcacggccctgttcaccaagcgctacagc
atccgccccctcatcgtggcgctcatcctgcgctccatctactatctgggcatcgggccc
acactcaacatcctgggtgccctcaatctgaccaacaagatcgtgtttgtggtgagcttc
gtgggcaaccgtggcaccttcatccggggctataaggccatggtcatggacatggaattc
ctctaccacgtgggctacatcctgaccagtgtcctgggcctctttgctcatgagctgttc
tacagcatcctgctctttgacctcatctaccgcgaggagacgctgttcaacgtcatcaag
agtgtgacccgcaatggccgctccatcctgctgacagccctgctggccctcatcctggtc
tacctcttctccatcgtcggcttcctcttcctcaaggatgacttcattctcgaggtcgac
cggctgcccaacaaccactccacagccagccccctggggatgccacatggagctgctgca
tttgtggacacctgcagtggggacaagatggactgtgtctcaggggtctcggtgcctgag
gtcctggaagaggacagggagctggacagcacagagcgggcctgtgacactctgttgatg
tgcatcgtcactgtcatgaaccatgggctacgcaatggtggtggcgtgggcgacattctc
cgcaagccctccaaagatgagtctctcttcccagcccgagtggtctatgacctcctgttc
ttcttcatcgtcatcatcattgtgctgaacctcatctttggggtaatcatcgacaccttc
gctgacctgcgtagtgagaagcagaagaaggaggagattcttaagacgacatgcttcatc
tgtggtctggagagggacaagtttgataacaagacagtgtcatttgaggaacacatcaag
ctggagcacaacatgtggaactacttgtacttcattgtgctggtccgcgtgaagaacaag
accgactacacgggccctgagagctacgtggcccagatgatcaagaacaagaacctggac
tggttcccccggatgcgggccatgtcccttgtcagcaacgagggcgagggggagcagaat
gagattcggattctccaggacaagctcaactccaccatgaagctggtgtcccacctcact
gcccagctcaacgagctcaaggagcagatgacggagcagcggaaacgcaggcaacgccta
ggctttgtggatgtccagaactgcattagccgctga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101151145
Entry
101151145         CDS       T02442                                 

Gene name
ITPR1
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 1 isoform X1
  KO
K04958  inositol 1,4,5-triphosphate receptor type 1
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04114  Oocyte meiosis
ggo04140  Autophagy - animal
ggo04210  Apoptosis
ggo04218  Cellular senescence
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04621  NOD-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05016  Huntington disease
ggo05017  Spinocerebellar ataxia
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05163  Human cytomegalovirus infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101151145 (ITPR1)
   04020 Calcium signaling pathway
    101151145 (ITPR1)
   04070 Phosphatidylinositol signaling system
    101151145 (ITPR1)
   04022 cGMP-PKG signaling pathway
    101151145 (ITPR1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101151145 (ITPR1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101151145 (ITPR1)
   04210 Apoptosis
    101151145 (ITPR1)
   04218 Cellular senescence
    101151145 (ITPR1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101151145 (ITPR1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101151145 (ITPR1)
   04621 NOD-like receptor signaling pathway
    101151145 (ITPR1)
   04625 C-type lectin receptor signaling pathway
    101151145 (ITPR1)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101151145 (ITPR1)
   04929 GnRH secretion
    101151145 (ITPR1)
   04912 GnRH signaling pathway
    101151145 (ITPR1)
   04915 Estrogen signaling pathway
    101151145 (ITPR1)
   04921 Oxytocin signaling pathway
    101151145 (ITPR1)
   04935 Growth hormone synthesis, secretion and action
    101151145 (ITPR1)
   04918 Thyroid hormone synthesis
    101151145 (ITPR1)
   04928 Parathyroid hormone synthesis, secretion and action
    101151145 (ITPR1)
   04924 Renin secretion
    101151145 (ITPR1)
   04925 Aldosterone synthesis and secretion
    101151145 (ITPR1)
   04927 Cortisol synthesis and secretion
    101151145 (ITPR1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101151145 (ITPR1)
  09154 Digestive system
   04970 Salivary secretion
    101151145 (ITPR1)
   04971 Gastric acid secretion
    101151145 (ITPR1)
   04972 Pancreatic secretion
    101151145 (ITPR1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101151145 (ITPR1)
   04725 Cholinergic synapse
    101151145 (ITPR1)
   04728 Dopaminergic synapse
    101151145 (ITPR1)
   04726 Serotonergic synapse
    101151145 (ITPR1)
   04720 Long-term potentiation
    101151145 (ITPR1)
   04730 Long-term depression
    101151145 (ITPR1)
   04723 Retrograde endocannabinoid signaling
    101151145 (ITPR1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101151145 (ITPR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101151145 (ITPR1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101151145 (ITPR1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101151145 (ITPR1)
   05012 Parkinson disease
    101151145 (ITPR1)
   05016 Huntington disease
    101151145 (ITPR1)
   05017 Spinocerebellar ataxia
    101151145 (ITPR1)
   05020 Prion disease
    101151145 (ITPR1)
   05022 Pathways of neurodegeneration - multiple diseases
    101151145 (ITPR1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101151145 (ITPR1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101151145 (ITPR1)
   05163 Human cytomegalovirus infection
    101151145 (ITPR1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101151145 (ITPR1)
Protein phosphatases and associated proteins [BR:ggo01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101151145 (ITPR1)
Ion channels [BR:ggo04040]
 Ligand-gated channels
  IP3 receptor
   101151145 (ITPR1)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Other DBs
NCBI-GeneID: 101151145
NCBI-ProteinID: XP_018879255
Ensembl: ENSGGOG00000005486
LinkDB
Position
3
AA seq 2770 aa
MSDKMSSFLHIGDICSLYAEGSTNGFISTLGLVDDRCVVQPETGDLNNPPKKFRDCLFKL
CPMNRYSAQKQFWKAAKPGANSTTDAVLLNKLHHAADLEKKQNETENRKLLGTVIQYGNV
IQLLHLKSNKYLTVNKRLPALLEKNAMRVTLDEAGNEGSWFYIQPFYKLRSIGDSVVIGD
KVVLNPVNAGQPLHASSHQLVDNPGCNEVNSVNCNTSWKIVLFMKWSDNKDDILKGGDVV
RLFHAEQEKFLTCDEHRKKQHVFLRTTGRQSATSATSSKALWEVEVVQHDPCRGGAGYWN
SLFRFKHLATGHYLAAEVDPDFEEECLEFQPSVDPDQDASRSRLRNAQEKMVYSLVSVPE
GNDISSIFELDPTTLRGGDSLVPRNSYVRLRHLCTNTWVHSTNIPIDKEEEKPVMLKIGT
SPVKEDKEAFAIVPVSPAEVRDLDFANDASKVLGSIAGKLEKGTITQNERRSVTKLLEDL
VYFVTGGTNSGQDVLEVVFSKPNRERQKLMREQNILKQIFKLLQAPFTDCGDGPMLRLEE
LGDQRHAPFRHICRLCYRVLRHSQQDYRKNQEYIAKQFGFMQKQIGYDVLAEDTITALLH
NNRKLLEKHITAAEIDTFVSLVRKNREPRFLDYLSDLCVSMNKSIPVTQELICKAVLNPT
NADILIETKLVLSRFEFEGVSSTGENALEAGEDEEEVWLFWRDSNKEIRSKSVRELAQDA
KEGQKEDRDVLSYYRYQLNLFARMCLDRQYLAINEISGQLDVDLILRCMSDENLPYDLRA
SFCRLMLHMHVDRDPQEQVTPVKYARLWSEIPSEIAIDDYDSSGASKDEIKERFAQTMEF
VEEYLRDVVCQRFPFSDKEKNKLTFEVVNLARNLIYFGFYNFSDLLRLTKILLAILDCVH
VTTIFPISKMAKGEENKGNNDVEKLKSSNVMRSIHGVGELMTQVVLRGGGFLPMTPMAAA
PEGNVKQAEPEKEDIMVMDTKLKIIEILQFILNVRLDYRISCLLCIFKREFDESNSQTSE
TSSGNSSQEGPSNVPGALDFEHIEEQAEGIFGGSEENTPLDLDDHGGRTFLRVLLHLTMH
DYPPLVSGALQLLFRHFSQRQEVLQAFKQVQLLVTSQDVDNYKQIKQDLDQLRSIVEKSE
LWVYKGQGPDETMDGASGENEHKKTEEGNNKPQKHESTSSYNYRVVKEILIRLSKLCVQE
SASVRKSRKQQQRLLRNMGAHAVVLELLQIPYEKAEDTKMQEIMRLAHEFLQNFCAGNQQ
NQALLHKHINLFLNPGILEAVTMQHIFMNNFQLCSEINERVVQHFVHCIETHGRNVQYIK
FLQTIVKAEGKFIKKCQDMVMAELVNSGEDVLVFYNDRASFQTLIQMMRSERDRMDENSP
LMYHIHLVELLAVCTEGKNVYTEIKCNSLLPLDDIVRVVTHEDCIPEVKIAYINFLNHCY
VDTEVEMKEIYTSNHMWKLFENFLVDICRACNNTSDRKHADSILEKYVTEIVMSIVTTFF
SSPFSDQSTTLQTRQPVFVQLLQGVFRVYHCNWLMPSQKASVESCIRVLSDVAKSRAIAI
PVDLDSQVNNLFLKSHNIVQKTAMNWRLSARNAARRDSVLAASRDYRNIIERLQDIVSAL
EDRLRPLVQAELSVLVDVLHRPELLFPENTDARRKCESGGFICKLIKHTKQLLEENEEKL
CIKVLQTLREMMTKDRGYGEKLISIDELDNAELPPAPDSENATEQELEPSPPLRQLEDHK
RGEALRQILVNRYYGNIRPSGRRESLTSFGNGPLSPGGPSKPGGGGGGSGSSSMSRGEMS
LAEVQCHLDKEGASNLVIDLIMNASSDRVFHESILLAIALLEGGNTTIQHSFFCRLTEDK
KSEKFFKVFYDRMKVAQQEIKATVTVNTSDLGNKKKDDEVDRDAPSRKKAKEPTTQITEE
VRDQLLEASAATRKAFTTFRREADPDDHYQPGEGTQATADKTKDDLEMSAVITIMQPILR
FLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEKNVA
LINQTLESLTEYCQGPCHENQNCIATHESNGIDIITALILNDINPLGKKRMDLVLELKNN
ASKLLLAIMESRHDSENAERILYNMRPKELVEVIKKAYLQGEVEFEDGENGEDGAASPRN
VGHNIYILAHQLARHNKELQSMLKPGGQVDGDEALEFYAKHTAQIEIVRLDRTMEQIVFP
VPSICEFLTKESKLRIYYTTERDEQGSKINDFFLRSEDLFNEMNWQKKLRAQPVLYWCAR
NMSFWSSISFNLAVLMNLLVAFFYPFKGVRGALPFEGFQKGRGTLEPHWSGLLWTAMLIS
LAIVIALPKPHGIRALIASTILRLIFSVGLQPTLFLLGAFNVCNKIIFLMSFVGNCGTFT
RGYRAMVLDVEFLYHLLYLVICAMGLFVHEFFYSLLLFDLVYREETLLNVIKSVTRNGRS
IILTAVLALILVYLFSIVGYLFFKDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVE
SGENCSSPAPREELVLAEETEQDKEHTCETLLMCIVTVLSHGLRSGGGVGDVLRKPSKEE
PLFAARVIYDLLFFFMVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDK
FDNKTVTFEEHIKEEHNMWHYLCFIVLVKVKDSTEYTGPESYVAEMIKERNLDWFPRMRA
MSLVSSDSEGEQNELRNLQEKLESTMKLVTNLSGQLSELKDQMTEQRKQKQRIGLLGHPP
HMNVNPQQPA
NT seq 8313 nt   +upstreamnt  +downstreamnt
atgtctgacaaaatgtctagcttcctacatattggagacatttgttctctgtacgcagag
ggatcgacaaatggatttattagcaccttgggcttggttgatgatcgttgtgttgtacag
ccagaaaccggggaccttaacaatccacctaagaaattcagagactgcctctttaagcta
tgtcccatgaaccgctactctgcccaaaagcagttctggaaagccgctaagcctggggcc
aacagcacaacagacgcagtgctactcaacaaactgcaccacgctgcagacttggaaaag
aagcagaatgagacagaaaacaggaaattgctggggaccgtaatccagtatggcaatgtg
atccagctcctgcatttgaaaagtaataaatacctaacagtgaataagaggcttcctgct
ctgttggagaagaatgccatgagagtcacattggacgaggctggaaatgaagggtcctgg
ttttatattcagccattctacaagctgcgatccattggagacagcgtggtcataggtgac
aaggttgttctgaaccccgtcaatgctggtcagcccctacatgctagcagccatcaactg
gtagataacccgggctgcaatgaggtcaattctgtcaactgcaatacaagctggaaaata
gtccttttcatgaaatggagtgataacaaagacgacatattaaaggggggtgacgtggtg
aggctgtttcatgctgagcaggagaagtttctcacctgtgatgaacacaggaagaagcag
catgtcttcctgagaaccacgggccggcagtcggccacatctgccaccagttcaaaagcc
ctgtgggaggtggaggtggtccagcatgacccatgtcggggcggagcagggtattggaac
agccttttccgtttcaagcatctggccacggggcattacttggcagcagaggtagaccct
gactttgaggaagaatgcctggagtttcagccctcagtagaccctgatcaggacgcctct
cgaagtaggttgcggaatgcccaagaaaagatggtatactccctggtctctgtgcctgaa
ggcaatgacatctcctccatttttgagctagaccccaccactctccgtggaggtgacagc
cttgtcccaaggaactcttatgttcggctcagacacctatgtactaatacctgggttcac
agcacaaatattcctattgacaaagaagaagaaaagcccgtgatgctgaaaattggcacc
tctcctgtgaaggaggataaggaagcatttgccatagttccagtttctcctgctgaagtt
cgggacctggactttgccaatgatgccagcaaggtgctgggctccattgctgggaagcta
gagaagggcaccatcacacagaatgaaaggaggtctgtaaccaagctgctagaagatttg
gtttacttcgtcactggtggaactaattctggtcaagatgttctcgaagttgtcttctcc
aagcccaacagagaacggcagaaactgatgagagaacagaatattctcaagcagatcttc
aagttgttacaagccccattcacagactgcggtgatggcccaatgcttcggctggaagag
ctcggggaccagcggcacgctcctttcagacacatctgccggctctgctacagggtgctg
agacactcgcagcaagactacaggaagaaccaggagtatatagccaagcagtttggcttc
atgcagaagcagattggctatgatgtgttggctgaagacactatcactgccctgctccac
aataatcggaaactcctggaaaaacacattaccgcggcagagattgacacatttgtcagc
ctggtgcgaaagaacagggagcccagattcttagattacctctctgacctctgtgtctcc
atgaacaaatcaattccagtgacccaggaactaatatgtaaagctgtgctgaatcccacc
aacgctgacatcctgattgagaccaagttggttctttctcgttttgaatttgaaggtgtt
tcttccactggagagaatgctctggaggcaggagaagacgaggaagaggtgtggctgttt
tggagggacagcaacaaagagattcgcagcaagagtgtgagggaattggctcaggatgct
aaagaagggcagaaggaggaccgagacgttctcagctactacagatatcagctgaacctc
tttgcgaggatgtgtctggaccgccaatacctggccatcaacgaaatctcaggccagctg
gatgtcgatctcattctccgctgcatgtctgacgagaacctgccctatgacctcagggca
tccttctgccgcctcatgcttcacatgcatgtggaccgagatccccaggaacaagtcacc
cccgtgaaatatgcccgcctctggtcggagattccctcggagatcgccattgacgactat
gatagtagtggagcttccaaagatgaaattaaggagagatttgctcagaccatggagttt
gtggaggagtatttaagagatgtggtttgtcagaggttccctttctctgataaggagaag
aataagcttacgtttgaggttgtaaatttagctaggaatctcatatactttggtttctac
aacttctctgaccttctacgattaactaagatccttctggccatattggactgtgtgcat
gtgacaacaatcttccccattagcaagatggcgaaaggagaagagaataaaggtaacaat
gatgtggagaagctgaagagcagtaacgtgatgagatctattcatggcgtgggagagctg
atgacccaggtggtgctccggggaggaggctttttgcccatgactcccatggctgctgcc
cctgaaggcaatgtgaagcaggcagagcctgagaaggaggacatcatggtcatggacacc
aagctgaagatcattgagatactccagtttattttgaatgtgaggttggattataggatc
tcctgcctcctgtgtatatttaagcgagagtttgatgaaagcaattcccagacttcagaa
acatcctccggaaacagcagccaagaagggccaagtaatgtaccaggtgctcttgacttt
gaacacattgaagaacaagcagaaggcatctttggaggaagcgaggagaacaccccactg
gacttggatgaccatggcggcagaacctttctccgggtcttgctccacttgacgatgcat
gactacccacccctggtgtcaggggccctgcagctcctcttccggcacttcagccagagg
caggaggtgctccaggccttcaaacaggttcaactgctggttaccagccaagatgtggac
aactacaaacagatcaaacaagacttggatcaactgaggtccatcgtggaaaagtcagag
ctttgggtgtacaaagggcagggccccgatgagactatggatggtgcatctggagaaaat
gaacataagaagacggaggagggaaataacaagccacaaaagcatgaaagcaccagcagc
tacaactacagagtagtcaaagagattttgattcggcttagcaaactctgtgttcaagag
agtgcctcagtgagaaagagcaggaagcagcaacagcgtctgctccggaacatgggcgcg
cacgccgtggtgctggagctgctgcagattccctatgagaaggccgaagataccaagatg
caagagataatgaggttggctcatgaatttttgcagaatttctgcgcaggcaaccagcag
aatcaagctttgctacataaacacataaacctgtttctcaacccagggatcctggaggca
gtaaccatgcagcacatcttcatgaacaatttccagctttgcagtgagatcaacgagaga
gttgttcagcacttcgttcactgcatagagactcacggtcggaatgtccagtatataaag
ttcttacagacaattgtcaaggcagaagggaaatttattaaaaaatgccaagacatggtt
atggccgagctggtcaattcgggagaggatgtcctcgtgttctacaacgacagagcctct
ttccagactctgatccagatgatgcggtcagaacgggatcggatggatgagaacagccct
ctcatgtaccacatccacttggtcgagctcctggctgtgtgcacggagggtaagaacgtc
tacacagagatcaagtgcaactctctgctcccgctggatgacatcgttcgcgtggtgacc
cacgaggactgcatccctgaggttaaaattgcatacattaacttcctgaatcactgctat
gtggatacagaggtggaaatgaaggagatttataccagcaatcacatgtggaaattgttt
gagaatttccttgtagacatctgcagggcctgtaacaacactagtgacaggaaacatgcg
gactcgattttggagaagtatgtcaccgaaatcgtcatgagtattgttactactttcttc
agctctcccttctcagaccagagtacgactttgcagactcgccaacctgtctttgtgcaa
ctgctgcaaggcgtgttcagggtttaccactgcaactggttaatgccaagccaaaaagcc
tccgtggagagctgtattcgggtgctgtctgatgtagccaagagccgggccattgccatt
cccgtggacctggacagccaagtcaacaacctctttctcaagtcccacaacattgtgcag
aaaacagccatgaactggcggctctcagctcgcaatgccgcacgcagggactctgttctg
gcagcttccagagactaccggaatatcattgagagattgcaggacatcgtctccgcgctg
gaggaccgtctcaggcccctggtgcaggcagagttatctgtgctcgtggatgttctccac
agacccgagctgcttttcccagagaacacagacgccagaaggaaatgtgaaagtggcggt
ttcatttgcaagttaataaagcatacaaaacagctgctagaagaaaatgaagagaagctc
tgcattaaggtcctacagaccctgagggaaatgatgaccaaagatagaggctatggagaa
aagctaatttccattgatgaattggataatgctgagcttcctccagctccggattctgag
aacgccaccgagcaggagcttgaaccaagtccacccctgcggcagctggaagaccataaa
aggggtgaggcactcaggcaaattctggtcaaccgttactatggaaacatcagaccttcg
ggaagaagagagagccttaccagctttggcaatggcccactgtcaccaggaggacccagc
aagcccgggggaggagggggaggttccggatccagctctatgagcaggggtgagatgagt
ctggccgaggttcagtgtcaccttgacaaggagggggcttccaatctagttatcgacctc
atcatgaacgcatccagtgaccgagtgttccatgaaagcattctcctggccattgccctt
ctggaaggaggcaacaccaccatccagcactcctttttctgtcgcttgacagaagataag
aagtcagagaaattctttaaggtgttttatgaccggatgaaggtggcccagcaagaaatc
aaagcaacggtgacagtgaacaccagtgacttgggaaataaaaagaaagacgatgaggta
gacagggatgccccatcacggaaaaaagctaaagagcccacaacacagataacagaagag
gtccgggatcagctcctggaggcctctgctgccaccaggaaagccttcaccactttcagg
agggaggccgatcccgacgaccactaccagcctggagagggcacccaggccactgccgac
aagaccaaggatgacctggagatgagcgcagtcatcaccatcatgcagcccatcctccgc
ttccttcagctcctgtgtgaaaaccacaaccgagacctgcagaacttcctccgttgccaa
aataacaagaccaactacaatttggtatgtgagaccctgcagtttctggactgtatctgt
ggaagcacaactggaggccttggtcttctgggcttgtatataaatgaaaagaacgtagcg
cttatcaaccaaaccctggaaagtctgaccgaatactgtcaaggaccttgccatgagaac
cagaactgcatagccacccatgaatccaatggcattgacatcatcacagccctgatcctc
aatgatatcaatcctttgggaaagaagaggatggaccttgtgttagaactgaagaacaat
gcctcgaagttgctcctggccatcatggaaagcaggcacgacagtgaaaacgcagagagg
atactttataacatgaggcccaaggaactggtggaagtgatcaagaaagcctacctgcaa
ggtgaagtggaatttgaggatggagaaaacggtgaggatggggcggcgtcccccaggaac
gtggggcacaacatctatatattagcccatcagttggctcggcataacaaagaacttcag
agcatgctgaaacctggtggccaagtggacggagatgaagccctggagttttatgccaag
cacacggcgcagatagagattgtcagattagaccgaacaatggaacagatagtctttccc
gtgcccagcatatgtgaattcctaaccaaggagtcaaaactacgaatttactatactaca
gagagagacgaacaaggcagcaaaatcaatgatttctttctgcggtctgaagacctcttc
aatgaaatgaattggcagaagaaactgagagcccagcccgtgttgtactggtgtgcccgc
aacatgtctttctggagcagcatttcgtttaacctggccgtcctgatgaacctgcttgtg
gcgtttttctacccattcaagggagtccgaggagctttgccttttgaaggatttcaaaag
ggaagaggaaccctggagccccactggtcgggactcctgtggacagccatgctcatctct
ctggccatcgtcattgccctccccaagccccatggcatccgggccttaattgcctccaca
attctacgattgatattttcagttgggttacaacccacgttgtttcttctgggagctttc
aatgtatgcaataaaatcatctttctaatgagctttgtgggcaactgtgggacattcaca
agaggctaccgagccatggttctggatgttgagttcctctatcatttgttgtatctggtg
atctgtgccatggggctctttgtccatgaattcttctacagtctgctgctttttgattta
gtgtacagagaagagactttgcttaatgtcattaaaagtgtcactcgcaatggacggtcc
atcatcctgacagcagttctggctctgatcctcgtttacctgttctcaatagtgggctat
cttttcttcaaggatgactttatcttggaagtagataggctgcccaatgaaacagctgtt
ccagaaaccggcgagagtttggcaagcgagttcctgttctccgatgtgtgtagggtggag
agtggggagaactgctcctctcctgcacccagagaagagctggtccttgcagaagaaacg
gaacaggataaagagcacacatgtgagacgctgctgatgtgcattgtcactgtactgagt
cacgggctgcggagcgggggtggagtaggagatgtgctcaggaagccgtccaaagaggaa
cccctgtttgctgctagagttatttatgacctcttgttcttcttcatggtcatcatcatt
gttcttaacctgatttttggggttatcattgacacttttgctgacctgaggagtgagaag
cagaagaaggaagagatcttgaagaccacgtgctttatctgtggcttggaaagagacaag
tttgacaacaagactgtcacctttgaagagcacatcaaggaagaacacaacatgtggcac
tatctgtgcttcatcgtcctggtgaaagtaaaggactccaccgaatatactgggcctgag
agttacgtggcagaaatgatcaaggaaagaaaccttgactggttccccaggatgagagcc
atgtcattggtcagcagtgattctgaaggagaacagaatgagctgagaaacctgcaggag
aagctggagtccaccatgaaacttgtcacgaacctttctggccagctgtcggaattaaag
gatcagatgacagaacaaaggaagcagaaacaaagaattggtcttctaggacatcctcct
cacatgaatgtcaacccacaacaaccagcataa

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101151502
Entry
101151502         CDS       T02442                                 

Gene name
ITPR2
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 2
  KO
K04959  inositol 1,4,5-triphosphate receptor type 2
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04114  Oocyte meiosis
ggo04210  Apoptosis
ggo04218  Cellular senescence
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04621  NOD-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05017  Spinocerebellar ataxia
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05163  Human cytomegalovirus infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101151502 (ITPR2)
   04020 Calcium signaling pathway
    101151502 (ITPR2)
   04070 Phosphatidylinositol signaling system
    101151502 (ITPR2)
   04022 cGMP-PKG signaling pathway
    101151502 (ITPR2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101151502 (ITPR2)
   04210 Apoptosis
    101151502 (ITPR2)
   04218 Cellular senescence
    101151502 (ITPR2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101151502 (ITPR2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101151502 (ITPR2)
   04621 NOD-like receptor signaling pathway
    101151502 (ITPR2)
   04625 C-type lectin receptor signaling pathway
    101151502 (ITPR2)
  09152 Endocrine system
   04922 Glucagon signaling pathway
    101151502 (ITPR2)
   04929 GnRH secretion
    101151502 (ITPR2)
   04912 GnRH signaling pathway
    101151502 (ITPR2)
   04915 Estrogen signaling pathway
    101151502 (ITPR2)
   04921 Oxytocin signaling pathway
    101151502 (ITPR2)
   04935 Growth hormone synthesis, secretion and action
    101151502 (ITPR2)
   04918 Thyroid hormone synthesis
    101151502 (ITPR2)
   04928 Parathyroid hormone synthesis, secretion and action
    101151502 (ITPR2)
   04924 Renin secretion
    101151502 (ITPR2)
   04925 Aldosterone synthesis and secretion
    101151502 (ITPR2)
   04927 Cortisol synthesis and secretion
    101151502 (ITPR2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101151502 (ITPR2)
  09154 Digestive system
   04970 Salivary secretion
    101151502 (ITPR2)
   04971 Gastric acid secretion
    101151502 (ITPR2)
   04972 Pancreatic secretion
    101151502 (ITPR2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101151502 (ITPR2)
   04725 Cholinergic synapse
    101151502 (ITPR2)
   04728 Dopaminergic synapse
    101151502 (ITPR2)
   04726 Serotonergic synapse
    101151502 (ITPR2)
   04720 Long-term potentiation
    101151502 (ITPR2)
   04730 Long-term depression
    101151502 (ITPR2)
   04723 Retrograde endocannabinoid signaling
    101151502 (ITPR2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101151502 (ITPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101151502 (ITPR2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101151502 (ITPR2)
   05012 Parkinson disease
    101151502 (ITPR2)
   05017 Spinocerebellar ataxia
    101151502 (ITPR2)
   05020 Prion disease
    101151502 (ITPR2)
   05022 Pathways of neurodegeneration - multiple diseases
    101151502 (ITPR2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101151502 (ITPR2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101151502 (ITPR2)
   05163 Human cytomegalovirus infection
    101151502 (ITPR2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101151502 (ITPR2)
Ion channels [BR:ggo04040]
 Ligand-gated channels
  IP3 receptor
   101151502 (ITPR2)
SSDB
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans DUF2207
Other DBs
NCBI-GeneID: 101151502
NCBI-ProteinID: XP_030856531
Ensembl: ENSGGOG00000008010
LinkDB
Position
12
AA seq 2701 aa
MTEKMSSFLYIGDIVSLYAEGSVNGFISTLGLVDDRCVVHPEAGDLANPPKKFRDCLFKV
CPMNRYSAQKQYWKAKQAKQGNHTEAALLKKLQHAAELEQKQNESENKKLLGEIVKYSNV
IQLLHIKSNKYLTVNKRLPALLEKNAMRVSLDAAGNEGSWFYIHPFWKLRSEGDNIVVGD
KVVLMPVNAGQPLHASNIELLDNPGCKEVNAVNCNTSWKITLFMKYSSYREDVLKGGDVV
RLFHAEQEKFLTCDEYEKKQHIFLRTTLRQSATSATSSKALWEIEVVHHDPCRGGAGQWN
SLFRFKHLATGNYLAAELNPDYRDAQNEGKNVRDGVPPTSKKKRQAGEKIMYTLVSVPHG
NDIASLFELDATTLQRADCLVPRNSYVRLRHLCTNTWVTSTSIPIDTDEERPVMLKIGTC
QTKEDKEAFAIVSVPLSEVRDLDFANDANKVLATTVKKLENGTITQNERRFVTKLLEDLI
FFVADVPNNGQEVLDVVITKPNRERQKLMREQNILAQVFGILKAPFKEKAGEGSMLRLED
LGDQRYAPYKYMLRLCYRVLRHSQQDYRKNQEYIAKNFCVMQSQIGYDILAEDTITALLH
NNRKLLEKHITAKEIETFVSLLRRNREPRFLDYLSDLCVSNTTAIPVTQELICKFMLSPG
NADILIQTKVVSMQADNPMESSILSDDIDDEEVWLYWIDSNKEPHGKAIRHLAQEAKEGT
KADLEVLTYYRYQLNLFARMCLDRQYLAINQISTQLSVDLILRCVSDESLPFDLRASFCR
LMLHMHVDRDPQESVVPVRYARLWTEIPTKITIHEYDSITDSSRNDMKRKFALTMEFVEE
YLKEVVNQPFPFGDKEKNKLTFEVVHLARNLIYFGFYSFSELLRLTRTLLAILDIVQAPM
SSYFERLSKFQDGGNNVMRTIHGVGEMMTQMVLSRGSIFPMSVPDVPPSIHPSKQGSPTE
HEDVTVMDTKLKIIEILQFILSVRLDYRISYMLSIYKKEFGEDNDNAETSASGSPDTLLP
SAIVPDIDEIAAQAETMFAGRKEKNPVQLDDEGGRTFLRVLIHLIMHDYPPLLSGALQLL
FKHFSQRAEVLQAFKQVQLLVSNQDVDNYKQIKADLDQLRLTVEKSELWVEKSSNYENGE
IGESQVKGGEEPIEESNILSPVQDGTKKPQIDSNKSNNYRIVKEILIRLSKLCVQNKKCR
NQHQRLLKNMGAHSVVLDLLQIPYEKNDEKMNEVMNLAHTFLQNFCRGNPQNQVLLHKHL
NLFLTPGLLEAETMRHIFMNNYHLCNEISERVVQHFVHCIETHGRHVEYLRFLQTIVKAD
GKYVKKCQDMVMTELINGGEDVLIFYNDRASFPILLHMMCSERDRGDESGPLAYHITLVE
LLAACTEGKNVYTEIKCNSLLPLDDIVRVVTHDDCIPEVKIAYVNFVNHCYVDTEVEMKE
IYTSNHIWKLFENFLVDMARVCNTTTDRKHADIFLEKCVTESIMNIVSGFFNSPFSDNST
SLQTHQPVFIQLLQSAFRIYNCTWPNPAQKASVESCIRTLAEVAKNRGIAIPVDLDSQVN
TLFMKSHSNMVQRAAMGWRLSARSGPRFKEALGGPAWDYRNIIEKLQDVVASLEHQFSPM
MQAEFSVLVDVLYSPELLFPEGSDARIRCGAFMSKLINHTKKLMEKEEKLCVKILQTLRE
MLEKKDSFAEEGNTLRKILLNRYFKGDYSIGVNGHLSGAYSKTAQVGGSFSGQDSDKMGI
SMSDIQCLLDKEGASELVIDVIVNTKNDRIFSEGIFLGIALLEGGNTQTQYSFYQQLHEQ
KKSEKFFKVLYDRMKAAQKEIRSTVTVNTIDLGNKKRDDDNELMTSGPRMRVRDSTLHLK
EGMKGQLTEASSATSKAYCVYRREMDPEIDIMCTGPEAGNTEEKSAEEVTMSPAIAIMQP
ILRFLQLLCENHNRELQNFLRNQNNKTNYNLVCETLQFLDCICGSTTGGLGLLGLYINEK
NVALVNQTLESLTEYCQGPCHENQTCIATHESNGIDIIIALILNDINPLGKYRMDLVLQL
KNNASKLLLAIMESRHDSENAERILFNMRPRELVDVMKNAYNQGLECDHGDDEGGDDGVS
PKDVGHNIYILAHQLARHNKLLQQMLKPGLDPDEGDEALKYYANHTAQIEIVRHDRTMEQ
IVFPVPNICEYLTRESKCRVFNTTERDEQGSKVNDFFQQTEDLYNEMKWQKKIRNNPALF
WFSRHISLWGSISFNLAVFINLAVALFYPFGDDGDEGTLSPLFSVLLWIAVAICTSMLFF
FSKPVGIRPFLVSIMLRSIYTIGLGPTLILLGAANLCNKIVFLVSFVGNRGTFTRGYRAV
ILDMAFLYHVAYVLVCMLGLFVHEFFYSFLLFDLVYREETLLNVIKSVTRNGRSIILTAV
LALILVYLFSIIGFLFLKDDFTMEVDRLKNRTPVTGSHQVPTMTLTTMMEACAKENCSPT
IPASNTADEEYEDGIERTCDTLLMCIVTVLNQGLRNGGGVGDVLRRPSKDEPLFAARVVY
DLLFYFIVIIIVLNLIFGVIIDTFADLRSEKQKKEEILKTTCFICGLERDKFDNKTVSFE
EHIKSEHNMWHYLYFIVLVKVKDPTEYTGPESYVAQMIVEKNLDWFPRMRAMSLVSNEGD
SEQNEIRSLQEKLESTMSLVKQLSGQLAELKEQMTEQRKNKQRLGFLGSNTPHVNHHMPP
H
NT seq 8106 nt   +upstreamnt  +downstreamnt
atgactgagaaaatgtccagcttcctctacataggggacatcgtgtccctgtacgcggag
ggctcggtcaacggcttcatcagcaccttggggttagtggatgacagatgtgtggtgcac
ccagaggccggggaccttgccaaccctcccaagaagttcagagactgccttttcaaggtg
tgccctatgaacagatattctgcccagaagcaatattggaaagcaaagcaagccaaacaa
gggaaccacaccgaggcagccttgctgaagaaactacagcatgctgcagaactggaacaa
aaacaaaatgaatcagagaataagaaactgttgggagaaattgtgaaatacagtaatgtt
atacaactactgcatataaaaagcaacaaatatcttactgtcaacaagagattacctgct
ttactggagaagaatgccatgcgtgtgtccttggatgctgcaggaaatgaagggtcttgg
ttttatattcatccgttctggaaactgagaagcgagggtgacaatattgttgtaggagat
aaagttgttttgatgcctgtgaatgcagggcagccactacatgccagcaacatagagctt
cttgataacccagggtgtaaagaggtgaatgctgttaattgcaacaccagctggaaaatc
actttattcatgaaatacagttcctatcgagaggatgtattaaaaggaggggacgttgtt
agattatttcatgcggaacaagagaagtttttgacttgtgatgaatatgagaaaaaacag
cacattttccttcgtacgaccttgcgccaatcagctacttctgctactagttctaaagca
ctctgggaaatagaggtggttcatcatgacccatgccgtgggggtgcaggacagtggaac
agcttgttcagatttaagcatcttgcaactggaaactatttagctgcagagcttaatcct
gattatcgagatgcccaaaatgaaggaaaaaatgtgagagatggagtccctccaacttca
aagaaaaaacgccaggcaggggagaagatcatgtatactttggtttcagtcccgcatggc
aatgacattgcatccctttttgaactagatgccacaactcttcagagagctgactgcctg
gttccaaggaactcatatgttcggttaaggcatttatgcaccaacacttgggtaaccagt
actagtatccccatagacacagatgaagagaggcctgttatgttaaagattggaacctgc
caaaccaaagaagataaagaagcgttcgcaatcgtgtctgttccactgtctgaagttcga
gacttagactttgccaatgatgccaataaagtactagcgaccacagttaaaaagctagaa
aacggcacaataactcagaatgaaaggaggtttgtaaccaaattattggaagacctcata
ttctttgttgctgatgtgcctaataatggacaagaagttctggatgtggttatcactaag
ccaaaccgagagcgtcaaaaattgatgagggaacaaaacatactggcacaggtatttgga
attcttaaagcaccctttaaagagaaagcaggagaaggctcgatgctgagacttgaagat
ctgggggatcaaagatatgcaccctacaagtacatgctacggctctgttaccgcgtcctg
agacactcgcagcaggattaccggaaaaatcaggaatatattgctaagaatttctgtgtc
atgcagtcccagattggctatgatattttggcagaagatactatcacagctttgttgcac
aacaacagaaaactactagagaaacatatcacagcaaaagaaatagaaacatttgtcagt
ttactcaggagaaatcgggagccaaggtttttggattatttgtcagatctgtgtgtgtct
aataccactgctatccctgtaactcaagaactcatctgtaaatttatgttgagtccaggc
aatgcagacattctcattcaaactaaggtggtctcaatgcaagcagacaaccccatggag
agctccatcctttcggatgacattgatgatgaagaagtttggctctattggattgacagc
aacaaggaacctcatggcaaagctatcaggcaccttgctcaagaggcaaaagaaggcacc
aaagctgacttagaagttcttacctattacaggtaccagctaaacctctttgcaaggatg
tgcttggatcgccagtatctggccataaaccagatttctacacagctgtctgtagacctg
atcctgcggtgtgtgtcggatgagagcctgccgttcgacctccgagcgtccttctgtcgc
ctcatgctccacatgcacgttgaccgggatccccaggagtccgtggtgcctgttcgctat
gccaggctctggacagaaatccccacaaagatcacaattcatgaatatgattctataaca
gactcttccagaaatgatatgaagaggaaatttgccctgacaatggaatttgttgaagaa
tatttgaaagaagttgtaaaccagccctttccttttggggataaagaaaaaaataaactg
acatttgaggtggtccacttggctcggaatcttatatactttggattttatagtttcagt
gagttattaaggctaacaagaacacttctggctattttagacattgtacaggcccccatg
tcatcatactttgaaagattaagcaaatttcaagatggaggaaacaatgtgatgagaacc
attcatggggtgggagagatgatgacccagatggtactcagtagaggctccatcttcccc
atgagcgtgccggatgtgccacccagcatccacccgagcaagcaagggagccccaccgag
cacgaggatgtgactgtgatggacaccaagctgaagatcattgagattttgcagtttatc
ctgagtgtgagactggattataggatctcatatatgctgtcaatatataagaaggagttt
ggagaggacaatgacaatgcggagacatctgccagtggatctccagacactttactacca
tcagctattgttcctgatatagatgaaattgcagctcaggcagaaactatgtttgcggga
agaaaggaaaaaaatccagttcaacttgacgatgaaggaggcaggacgtttttacgggtc
ctcattcatctgatcatgcacgactacccgcctttgctgtctggagccctgcagctgttg
tttaagcacttcagccagagggcggaggttttacaggcatttaagcaggtgcaattactg
gtgtctaatcaagacgtagataactacaagcaaatcaaggcagatctagaccagcttcga
ctgacagtagaaaagtctgagctatgggtggagaagagcagcaactatgagaatggagaa
ataggggaaagtcaagtgaaaggtggtgaagagccaattgaggaatcgaacattttaagt
ccagtgcaggatggaacaaagaaacctcagattgacagcaacaagagcaataactaccgg
attgtaaaggagattttgatcaggctaagtaaactctgtgtacagaataaaaagtgtcgg
aatcaacatcaacgattactgaaaaatatgggggcgcattcggtggtgttggatcttctg
cagataccctatgaaaagaatgatgaaaagatgaatgaagtaatgaatctagcccataca
tttctgcagaatttctgtcgaggaaatccacagaatcaagttcttcttcataaacatctg
aatttgtttttaactccaggtctccttgaagcagaaaccatgcggcacatcttcatgaac
aattaccatctgtgcaatgaaattagcgagagagttgtacagcactttgtgcactgcatt
gagacacatggccgccacgtggagtacctgaggtttttgcaaacaattgtaaaagcagat
ggtaaatatgtgaagaaatgccaggatatggtaatgacagagttgataaatgggggtgaa
gacgtgctgatattttacaatgatagagcatcatttccaatccttctccatatgatgtgt
tcagagagagaccgaggggatgagagtggccccttagcctaccacatcaccctggtggag
ttgctggcagcatgcacagaggggaaaaatgtctacactgaaatcaagtgtaattccctt
ctcccgctggacgacatagtgagggtggtgacccatgacgactgcatccctgaggttaaa
attgcttatgtgaactttgttaatcactgttatgttgacactgaagtggaaatgaaagaa
atctatacaagtaaccacatttggaaattatttgagaacttcttggtggatatggcaagg
gtttgcaacacaactacagacaggaaacatgcagacatctttttggaaaagtgtgttact
gagtcaataatgaatattgtgagcggcttctttaattctcccttttcagacaatagtacc
agcctccagacacatcagccagtttttattcagctactgcagtctgccttcagaatttac
aattgcacctggccaaacccagcgcagaaagcctcagtggaatcctgtatcagaactttg
gctgaagtggcaaaaaatcgtggaattgccattccagtggatttggacagccaagttaat
actcttttcatgaagagccattcaaatatggtgcagagagcagcaatgggttggagacta
tcagctcgctctgggccacgctttaaggaagctcttggagggcctgcttgggattacaga
aatattattgaaaaattacaggatgtagtggcctccttggagcaccagttcagcccaatg
atgcaggctgaattctcagtgttggttgatgtattgtacagtccagaactgctgttccct
gagggaagcgatgcaagaataagatgtggcgctttcatgtcgaagttgattaatcataca
aagaaactaatggagaaagaagaaaaactgtgcgttaaaattcttcagacattacgagaa
atgttagagaagaaagacagctttgcggaagagggtaacacattaagaaagatacttctg
aatcgatactttaaaggtgattatagtattggtgtgaacggacacctatcgggagcctac
tccaaaactgcacaggtgggaggaagcttttctggacaagattcagataagatggggata
tcaatgtcagacattcagtgtctgctggataaagaaggtgcatcagaacttgtcatcgat
gttatagtgaacaccaaaaatgacagaattttttcagaaggcattttcctcggcattgcc
ttgcttgaaggaggaaatacacaaacacagtattctttctaccagcagttgcatgaacaa
aaaaagtcagaaaaattctttaaagttctctatgatcgaatgaaggctgctcagaaagaa
ataagatcaacagtgacagttaataccatagatttaggtaacaaaaaaagggacgatgac
aatgaattgatgacatctggtccacgaatgagagtaagagattcaaccctacatttaaaa
gagggaatgaaagggcaattaacagaagcttcttcagcaacatccaaagcatattgtgta
tacagaagagaaatggatccagaaatagacattatgtgcacaggaccagaagcgggaaac
actgaggaaaaatctgcagaggaagtaacaatgagtcccgcaattgccatcatgcagcca
atactgagatttcttcagttactgtgtgagaatcacaaccgggaattgcagaacttcttg
aggaatcaaaacaacaaaacaaattacaacctagtctgtgagacccttcagtttctggac
tgcatttgtggaagtacaaccggtggcctgggcctgttgggtctctacatcaatgagaag
aatgtagcgctggtcaaccagaccctggagagcttgactgagtattgccagggcccttgc
catgaaaatcagacctgtatcgctacacatgaatctaatgggattgatatcatcattgct
ttgattctgaatgacataaaccctcttggtaaataccgaatggacctggtgctccagcta
aagaacaatgcatctaaacttttgctggccattatggaaagcagacatgacagtgagaat
gcagaaagaattctttttaacatgagacccagagaactggtggatgtgatgaagaatgcc
tataaccaaggattggaatgtgaccatggggatgatgagggtggagatgatggtgtttct
ccaaaagatgttggacacaatatctatattctggcccatcagttggcccgccacaataaa
ctattgcagcagatgctcaaaccaggattggatccagatgaaggagatgaagccttaaag
tattatgccaaccacactgcacagattgagattgtccggcatgataggaccatggaacaa
atagtttttcctgtccccaatatatgtgaatacctcactcgagaatccaagtgccgtgtg
ttcaatacaactgaaagggatgaacaaggaagtaaagtgaatgactttttccagcaaaca
gaagatctctacaatgaaatgaagtggcagaagaaaatcaggaataaccctgcactgttc
tggttctcgaggcacatctctctctgggggagcatttccttcaacctggctgtgttcatc
aatttagctgttgctctcttctacccatttggggatgatggagatgaaggtacactttct
ccattgttctcggttcttctttggatagcagttgcgatctgcacatctatgctgtttttc
ttctccaagcctgtgggtattcggccgtttcttgtatcaataatgctcagatcaatatat
acaataggtcttgggcctacattaatacttcttggtgcagctaatctttgtaataaaatt
gtttttctggtgagttttgttggaaatcgtggcacgttcacccgtgggtaccgagcagtc
atcctggatatggcctttctctatcacgtggcgtatgtcctggtttgcatgctgggcctt
tttgtccatgaattcttctatagcttcctgctttttgatttggtgtacagagaagagact
ttgctgaatgtcataaaaagtgtcacacgaaatggccgctctattattctaactgcagtc
ctggctctcatcctcgtctacctgttttccattattgggttcctttttttgaaggatgac
ttcactatggaagttgataggctgaaaaaccgaactcctgttacaggcagtcatcaagtg
cctactatgactttaactaccatgatggaagcatgtgccaaggagaactgttcacccaca
attccagcttcaaatacagctgatgaagagtatgaagatggaattgaaaggacgtgtgac
actctccttatgtgcattgtcaccgtgctgaaccagggcctcaggaatggcggtggtgtg
ggggatgtgctaagaaggccatcaaaagatgagcccttgtttgctgcccgagtggtttat
gaccttcttttttatttcattgttatcattattgttctgaacttgatttttggtgttatc
atcgatacttttgctgatctcagaagcgaaaaacagaaaaaagaagaaattctaaagaca
acttgtttcatctgtggacttgagagagacaagtttgataataaaacggtttcatttgag
gagcacattaagtcagaacacaatatgtggcattatttgtacttcatagtcctggtgaaa
gttaaagacccaacagaatacactggacctgaaagttatgtggctcaaatgattgtggag
aagaatttggattggtttcctcggatgcgagccatgtccctcgttagcaatgaaggcgac
agtgagcaaaatgaaattcggagccttcaggagaagttggaatcgaccatgagtctggtc
aaacagctgtcgggtcagctggcggagctcaaggagcagatgacagaacaaaggaagaat
aagcagagactgggcttcctcggatcaaacacaccccatgtgaatcatcacatgccacca
cactga

DBGET integrated database retrieval system