KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124803Help
Entry
101124803         CDS       T02442                                 

Gene name
TGM1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    101124803 (TGM1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     101124803 (TGM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 101124803
NCBI-ProteinID: XP_018864843
Ensembl: ENSGGOG00000016125
UniProt: G3RJ54
LinkDB All DBs
Position
14
AA seq 818 aa AA seqDB search
MMDGPRSDVGRWGGNPLQPPTTPSPEPEPEPDGRSRRGGGGRSFWARCCGCCSCRHAADD
DWGPEPSDSRGRGSSSGTRRPGSRGSDSRRPVSRGSGVNAAGDGTIREGMLVVNGVDLLS
SRSDQNRREHHTDEYEYDELIVRRGQPFHMLLLLSRTYESSDRITLELLIGNNPEVGKGT
HVIIPVGKGGSGGWKAQVVKASGQNLNLRVHTSPNAIIGKFQFTVRTQSDAGEFQLPFDP
RNEIYIIFNPWCPEDIVYVDHEDWRQEYVLNESGRIYYGTEAQIGERTWNYGQFDHGVLD
ACLYILDRRGMPYGGRGDPVSVSRVISAMVNSLDDNGVLIGNWSGDYSRGTNPSAWVGSV
EILLSYLRTGYSVPYGQCWVFAGVTTTVLRCLGLATRTVTNFNSAHDTDTSLTMDIYFDE
NMKPLEHLNHDSVWNFHVWNDCWMKRPDLPSGFDGWQVVDATPQETSSGIFCCGPCSVES
IKNGLVYMKYDTPFIFAEVNSDKVYWQRQDDGSFKIVYVEEKAIGTLIVTKAIGSNMRED
ITYLYKHPEGSDAERKAVETAAAHGSKPNVYANRGSAEDVAMQVEAQDAVMGQDLMVSVM
LTNHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHL
VDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPV
TLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVH
GVIQVDVAPAPGDGGFFSDAGGDSHLGETIPMASRGGA
NT seq 2457 nt NT seq  +upstreamnt  +downstreamnt
atgatggatgggccacgttccgatgtgggccgttggggtggcaaccccttgcagccccct
accacgccgtctccagagccagagccagagccagacggacgctctcgcagaggaggagga
ggccgttccttctgggctcgctgctgtggctgctgttcatgccgacatgcggccgatgac
gactggggacctgaaccctctgactccaggggtcgagggtccagctctggcactcgaaga
cctggctcccggggctcagactcccgccggcctgtatcccggggcagcggtgtcaatgca
gctggagatggcaccatccgagagggcatgctagtagtgaacggtgtggacttgctgagc
tcgcgctcagaccagaaccgccgagagcaccacacagacgagtatgagtacgacgagctg
atagtgcgccgcgggcagcctttccatatgctcctcctcctgtcccggacctatgaatcc
tctgatcgcatcacccttgagttactcatcggaaacaaccccgaggtgggcaagggcacg
cacgtgatcatcccagtgggcaaggggggcagtggaggctggaaagcccaggtggtcaag
gccagtgggcagaatctgaacctgcgggtccacacttcccccaacgccatcatcggcaag
tttcagttcacagtccgcacacaatcagacgctggggagttccagttgccctttgacccc
cgcaatgagatctacatcatcttcaacccctggtgcccagaggacattgtgtacgtggac
catgaggattggcggcaggagtatgttcttaatgagtctgggagaatttactatgggacc
gaagcacagattggtgagcggacctggaactacggacagtttgaccacggggtgctggat
gcctgcttatacatcctggaccggcgggggatgccatacggaggccgtggagacccagtc
agtgtctcccgggtcatctctgccatggtgaactccctggatgacaatggagtcctgatt
gggaactggtctggtgattactcccgaggcaccaacccatcagcgtgggtgggcagcgtg
gagatcctgcttagctacctacgcacgggatattccgtcccctatggccagtgctgggtc
tttgctggcgtgaccaccacagtgctgcgctgcctgggtctggccacccgtactgtcacc
aacttcaactccgcccacgacacagacacatcccttaccatggacatctacttcgacgag
aacatgaagcccctggagcacctgaaccatgattctgtctggaacttccatgtgtggaac
gactgctggatgaagaggccggatctgccctcaggctttgatgggtggcaggtggtggat
gccacgccccaagagactagcagtggcatcttctgctgcggcccctgctctgtggagtcc
atcaagaatggcctggtctacatgaagtacgacacgcctttcatttttgctgaggtgaat
agtgacaaggtgtactggcagcggcaggacgatggcagcttcaagattgtttatgtggag
gagaaggccatcggcacactcattgtcacaaaggccatcggctccaacatgcgggaggac
atcacctacctctataagcacccagaaggctcagatgcagagcggaaggcagtagagaca
gcagcagcccacggcagcaaacccaatgtgtatgccaaccggggctcagcggaggatgtg
gccatgcaggtggaggcacaggacgcggtgatggggcaggatctgatggtctctgtgatg
ctgaccaatcacagcagcagccgccgcacagtgaaactgcacctctacctctcagtcacc
ttctatactggtgtcagtggtaccatcttcaaggagaccaagaaggaagtggagctggca
ccaggggcctcggaccgtgtgaccatgccagtggcctacaaggaataccggccccatctt
gtggaccagggggccatgctgctcaatgtctcaggccacgtcaaggagagcgggcaggtg
ctggccaagcagcacaccttccgtctgcgcaccccagacctctccctcacgttactggga
gcagcagtggttggccaggagtgtgaagtacagattgtcttcaagaacccccttcccgtc
accctcaccaatgtcgtcttccggctcgaaggctctgggttacagaggcccaagatcctc
aacgttggggacattggaggcaatgaaacagtgacactgcgccagtcgtttgtacctgtg
cgaccaggcccccgccagctcattgccagcttggacagcccacagctctcccaggtgcac
ggtgtcatccaggtggatgtggccccagcccctggggacgggggcttcttctcagatgct
ggaggtgacagtcacttaggagagaccatccctatggcatctcgaggtggagcttag

DBGET integrated database retrieval system