KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124828
Entry
101124828         CDS       T02442                                 

Gene name
PRKCA
Definition
(RefSeq) protein kinase C alpha type
  KO
K02677  classical protein kinase C alpha type [EC:2.7.11.13]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01521  EGFR tyrosine kinase inhibitor resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04150  mTOR signaling pathway
ggo04151  PI3K-Akt signaling pathway
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04310  Wnt signaling pathway
ggo04360  Axon guidance
ggo04370  VEGF signaling pathway
ggo04510  Focal adhesion
ggo04540  Gap junction
ggo04613  Neutrophil extracellular trap formation
ggo04650  Natural killer cell mediated cytotoxicity
ggo04664  Fc epsilon RI signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04670  Leukocyte transendothelial migration
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04727  GABAergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04935  Growth hormone synthesis, secretion and action
ggo04960  Aldosterone-regulated sodium reabsorption
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo05017  Spinocerebellar ataxia
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05031  Amphetamine addiction
ggo05032  Morphine addiction
ggo05143  African trypanosomiasis
ggo05146  Amoebiasis
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05164  Influenza A
ggo05170  Human immunodeficiency virus 1 infection
ggo05171  Coronavirus disease - COVID-19
ggo05200  Pathways in cancer
ggo05205  Proteoglycans in cancer
ggo05206  MicroRNAs in cancer
ggo05214  Glioma
ggo05223  Non-small cell lung cancer
ggo05225  Hepatocellular carcinoma
ggo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101124828 (PRKCA)
   04012 ErbB signaling pathway
    101124828 (PRKCA)
   04014 Ras signaling pathway
    101124828 (PRKCA)
   04015 Rap1 signaling pathway
    101124828 (PRKCA)
   04310 Wnt signaling pathway
    101124828 (PRKCA)
   04370 VEGF signaling pathway
    101124828 (PRKCA)
   04066 HIF-1 signaling pathway
    101124828 (PRKCA)
   04020 Calcium signaling pathway
    101124828 (PRKCA)
   04070 Phosphatidylinositol signaling system
    101124828 (PRKCA)
   04072 Phospholipase D signaling pathway
    101124828 (PRKCA)
   04071 Sphingolipid signaling pathway
    101124828 (PRKCA)
   04151 PI3K-Akt signaling pathway
    101124828 (PRKCA)
   04150 mTOR signaling pathway
    101124828 (PRKCA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101124828 (PRKCA)
   04540 Gap junction
    101124828 (PRKCA)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    101124828 (PRKCA)
   04650 Natural killer cell mediated cytotoxicity
    101124828 (PRKCA)
   04664 Fc epsilon RI signaling pathway
    101124828 (PRKCA)
   04666 Fc gamma R-mediated phagocytosis
    101124828 (PRKCA)
   04670 Leukocyte transendothelial migration
    101124828 (PRKCA)
  09152 Endocrine system
   04911 Insulin secretion
    101124828 (PRKCA)
   04929 GnRH secretion
    101124828 (PRKCA)
   04912 GnRH signaling pathway
    101124828 (PRKCA)
   04921 Oxytocin signaling pathway
    101124828 (PRKCA)
   04926 Relaxin signaling pathway
    101124828 (PRKCA)
   04935 Growth hormone synthesis, secretion and action
    101124828 (PRKCA)
   04918 Thyroid hormone synthesis
    101124828 (PRKCA)
   04919 Thyroid hormone signaling pathway
    101124828 (PRKCA)
   04928 Parathyroid hormone synthesis, secretion and action
    101124828 (PRKCA)
   04916 Melanogenesis
    101124828 (PRKCA)
   04925 Aldosterone synthesis and secretion
    101124828 (PRKCA)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101124828 (PRKCA)
   04270 Vascular smooth muscle contraction
    101124828 (PRKCA)
  09154 Digestive system
   04970 Salivary secretion
    101124828 (PRKCA)
   04971 Gastric acid secretion
    101124828 (PRKCA)
   04972 Pancreatic secretion
    101124828 (PRKCA)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101124828 (PRKCA)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101124828 (PRKCA)
  09156 Nervous system
   04724 Glutamatergic synapse
    101124828 (PRKCA)
   04727 GABAergic synapse
    101124828 (PRKCA)
   04725 Cholinergic synapse
    101124828 (PRKCA)
   04728 Dopaminergic synapse
    101124828 (PRKCA)
   04726 Serotonergic synapse
    101124828 (PRKCA)
   04720 Long-term potentiation
    101124828 (PRKCA)
   04730 Long-term depression
    101124828 (PRKCA)
   04723 Retrograde endocannabinoid signaling
    101124828 (PRKCA)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101124828 (PRKCA)
  09158 Development and regeneration
   04360 Axon guidance
    101124828 (PRKCA)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101124828 (PRKCA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101124828 (PRKCA)
   05206 MicroRNAs in cancer
    101124828 (PRKCA)
   05205 Proteoglycans in cancer
    101124828 (PRKCA)
   05231 Choline metabolism in cancer
    101124828 (PRKCA)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101124828 (PRKCA)
   05214 Glioma
    101124828 (PRKCA)
   05223 Non-small cell lung cancer
    101124828 (PRKCA)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101124828 (PRKCA)
   05022 Pathways of neurodegeneration - multiple diseases
    101124828 (PRKCA)
  09165 Substance dependence
   05031 Amphetamine addiction
    101124828 (PRKCA)
   05032 Morphine addiction
    101124828 (PRKCA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101124828 (PRKCA)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101124828 (PRKCA)
   05161 Hepatitis B
    101124828 (PRKCA)
   05171 Coronavirus disease - COVID-19
    101124828 (PRKCA)
   05164 Influenza A
    101124828 (PRKCA)
   05163 Human cytomegalovirus infection
    101124828 (PRKCA)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101124828 (PRKCA)
   05143 African trypanosomiasis
    101124828 (PRKCA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101124828 (PRKCA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101124828 (PRKCA)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101124828 (PRKCA)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101124828 (PRKCA)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101124828 (PRKCA)
Membrane trafficking [BR:ggo04131]
 Endocytosis
  Lipid raft mediated endocytosis
   Caveolin-mediated endocytosis
    101124828 (PRKCA)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 APH
Other DBs
NCBI-GeneID: 101124828
NCBI-ProteinID: XP_004041162
Ensembl: ENSGGOG00000015929
UniProt: G3RIN3
LinkDB
Position
5
AA seq 672 aa
MADVFPGNDSTASQDVANRFARKGALRQKNVHEVKDHKFIARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPDTDDPRSKHKFKIHTYGSPTFCDHCGS
LLYGLIHQGMKCDTCDMNVHKQCVINVPSLCGMDHTEKRGRIYLKAEVADEKLHVTVRDA
KNLIPMDPNGLSDPYVKLKLIPDPKNESKQKTKTIRSTLNPQWNESFTFKLKPSDKDRRL
SVEIWDWDRTTRNDFMGSLSFGVSELMKMPASGWYKLLNQEEGEYYNVPIPEGDEEGNME
LRQKFEKAKLGPAGNKVISPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKG
TEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPFLTQLHSCFQTVDRLYFVMEYV
NGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKIA
DFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDG
EDEDELFQSIMEHNVSYPKSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRI
DWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTPPDQLVIANIDQSDFEGFSYVN
PQFVHPILQSAV
NT seq 2019 nt   +upstreamnt  +downstreamnt
atggctgacgttttcccgggcaacgactccacggcgtctcaggacgtggccaaccgcttc
gcccgcaaaggggcgctgaggcagaagaacgtgcacgaggtgaaggaccacaaattcatc
gcgcgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctgggggttt
gggaaacaaggcttccagtgccaagtttgctgttttgtggtccacaagaggtgccatgaa
tttgttactttttcttgtccgggtgcggataagggacccgacactgatgaccccaggagc
aagcacaagttcaaaatccacacttacggaagccccaccttctgcgatcactgtgggtca
ctgctctatggacttatccatcaagggatgaaatgtgacacctgcgatatgaacgttcac
aagcaatgcgtcatcaatgtccccagcctctgcggaatggatcacactgagaagaggggg
cggatttacctaaaggctgaggttgctgatgaaaagctccatgtcacagtacgagatgca
aaaaatctaatccctatggatccaaacgggctttcagatccttatgtgaagctgaaactt
attcctgatcccaagaatgaaagcaagcaaaaaaccaaaaccatccgctccacactaaat
ccgcagtggaatgagtcctttacattcaaattgaaaccttcagacaaagaccgacgactg
tctgtagaaatctgggactgggatcgaacaacaaggaatgacttcatgggatccctttcc
tttggagtttcggagctgatgaagatgccggccagtggatggtacaagttgcttaaccaa
gaagaaggtgagtactacaatgtacccattccggaaggggatgaagaaggaaacatggaa
ctcaggcagaaattcgagaaagccaaacttggccctgctggcaacaaagtcatcagtccc
tctgaagacaggaaacaaccttccaacaaccttgaccgagtgaaactcacggacttcaat
ttcctcatggtgttgggaaaggggagttttggaaaggtgatgcttgccgacaggaagggc
acagaagaactgtatgcaatcaaaatcctgaagaaggatgtagtgattcaggatgatgac
gtggagtgcaccatggtagaaaagcgagtcttggccctgcttgacaaacccccgttcttg
acgcagctgcactcctgcttccagacagtggatcggctgtacttcgtcatggagtatgtc
aacggcggggacctcatgtaccacattcagcaagtaggaaaatttaaggaaccacaagca
gtattctatgcggcagagatttccatcggattgttctttcttcataaaagaggaatcatt
tatagggatctgaagttagataacgtcatgttggattcagaaggacatatcaaaattgct
gactttgggatgtgcaaggaacacatgatggatggagtcacgaccaggaccttctgtggg
actccagattatatcgccccagagataatcgcttatcagccgtatggaaaatctgtggac
tggtgggcctatggcgtcctgttgtatgaaatgcttgctgggcagcctccatttgatggt
gaagatgaagacgagctatttcagtctatcatggagcacaacgtttcctatccaaaatcc
ttgtccaaggaggctgtttctatctgcaaaggactgatgaccaaacacccagccaagcgg
ctgggctgtgggcctgagggggagagggacgtgagagaacatgccttcttccggaggatc
gactgggaaaaactggagaacagggagatccagccaccattcaagcccaaagtgtgcggc
aaaggagcagagaactttgacaagttcttcacacgaggacagcccgtcttaacaccgcct
gatcagctggttattgctaacatagaccagtctgattttgaagggttctcgtatgtcaac
ccccagtttgtgcaccccatcttacagagtgcagtatga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101133370
Entry
101133370         CDS       T02442                                 

Gene name
PRKCD
Definition
(RefSeq) protein kinase C delta type
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04062  Chemokine signaling pathway
ggo04140  Autophagy - animal
ggo04270  Vascular smooth muscle contraction
ggo04621  NOD-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04722  Neurotrophin signaling pathway
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04930  Type II diabetes mellitus
ggo04931  Insulin resistance
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo05020  Prion disease
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101133370 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101133370 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    101133370 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    101133370 (PRKCD)
   04062 Chemokine signaling pathway
    101133370 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101133370 (PRKCD)
   04915 Estrogen signaling pathway
    101133370 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101133370 (PRKCD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101133370 (PRKCD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101133370 (PRKCD)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    101133370 (PRKCD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101133370 (PRKCD)
   04931 Insulin resistance
    101133370 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101133370 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101133370 (PRKCD)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101133370 (PRKCD)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101133370 (PRKCD)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C zf-RING-like C1_2 Zf_RING Kinase-like zf-RING_9 PHD DZR APH FYVE_2 DUF2318
Other DBs
NCBI-GeneID: 101133370
NCBI-ProteinID: XP_018879336
Ensembl: ENSGGOG00000003207
UniProt: G3QL13
LinkDB
Position
3
AA seq 676 aa
MAPFLRIAFNSYELGSLQAEDEANQPFCAVKMKEALSTERGKTLVQKKPTMYPEWKSTFD
AHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQAKVLMSVQY
FLEDVDCKQSMRSEDEAKFPTMNRRGAIKQAKIHYIKNHEFIATFFGQPTFCSVCKDFVW
GLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTAANSRDTIFQKERFNIDMPHRFKVHNYMS
PTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCREKVANLCGINQKLLAEALNQVTQRASR
RSDSASSEPVGIYQGFEKKTGVAGEDMQDNSGTYGKIWEGSSKCNINNFIFHKVLGKGSF
GKVLLGELKGRGEYFAIKALKKDVVLIDDDVECTMVEKRVLTLAAENPFLTHLICTFQTK
DHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIMCGLQFLHSKGIIYRDLKLDNVL
LDRDGHIKIADFGMCKENIFGENRASTFCGTPDYIAPEILQGLKYTFSVDWWSFGVLLYE
MLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLFEREPTKRLGVTGNIKIH
PFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAF
AGFSFVNPKFEHLLED
NT seq 2031 nt   +upstreamnt  +downstreamnt
atggcgccgttcctgcgcatcgccttcaactcctacgagctgggctccctgcaggctgag
gacgaggcgaaccagcccttctgtgctgtgaagatgaaggaggcgctcagcacagagcgt
gggaaaacactggtgcagaagaaaccgaccatgtatcctgagtggaagtcgacgttcgat
gcccacatctacgaggggcgcgtcatccagattgtgctaatgcgggcagcagaggagcca
gtgtctgaggtgaccgtgggtgtgtcggtgctggccgagcgctgcaagaagaacaatgga
aaggctgagttctggctggacctgcagcctcaggccaaggtgttgatgtctgttcagtat
ttcctggaggacgtggattgcaaacagtctatgcgcagtgaggacgaggccaagttccca
acgatgaaccgccgcggagccatcaaacaggccaaaatccactacatcaagaaccatgag
tttatcgccaccttctttgggcaacccaccttctgttctgtgtgcaaagactttgtctgg
ggcctcaacaagcaaggctacaaatgcaggcaatgtaacgctgccatccacaagaaatgc
atcgacaagatcatcggcagatgcactggcaccgcggccaacagccgggacactatattc
cagaaagaacgcttcaacatcgacatgccgcaccgcttcaaggttcacaactacatgagc
cccaccttctgtgaccactgcggcagcctgctctggggactggtgaagcagggattaaag
tgtgaagactgcggcatgaatgtgcaccataaatgccgggagaaggtggccaacctctgc
ggcatcaaccagaagcttttggctgaggccttgaaccaagtcacccagagagcctcccgg
agatcagactcagcctcctcagagcctgttgggatatatcagggtttcgagaagaagacc
ggagttgccggggaggacatgcaagacaacagtgggacctacggcaagatctgggagggc
agcagcaagtgcaacatcaacaacttcatcttccacaaggtcctgggcaaaggcagcttc
gggaaggtgctgcttggagagctgaagggcagaggagagtactttgccatcaaggccctc
aagaaggatgtggtcctgatcgacgacgacgtggaatgcaccatggttgagaagcgggtg
ctgacactcgccgcagagaatccctttctcacccacctcatctgcaccttccagaccaag
gaccacctgttctttgtgatggagttcctcaatgggggggacctgatgtaccacatccag
gacaaaggccgctttgaactctaccgtgccacgttttatgccgctgagataatgtgtgga
ctgcagtttctacacagcaagggcatcatttacagggacctcaaactggacaatgtgctg
ctggaccgggatggccacatcaagattgccgactttgggatgtgcaaagagaacatattc
ggggagaaccgggccagcaccttctgcggcacccctgactatatcgcccctgagatccta
cagggcctgaagtacacattctctgtggactggtggtctttcggggtccttctgtacgag
atgctcattggccagtcccccttccatggtgatgatgaggatgaactcttcgagtccatc
cgtgtggacacgccacattatccccgctggatcaccaaggagtccaaggacatcctggag
aagctctttgaaagggaaccaaccaagaggctgggagtgaccggaaacatcaaaatccac
cccttcttcaagaccataaactggactctgctggaaaagcggaggttggagccacccttc
aggcccaaagtgaagtcacccagagactacagcaactttgaccaggagttcctgaacgag
aaggcgcgcctctcctacagcgacaagaacctcatcgactccatggaccagtctgcattc
gccggcttctcctttgtgaaccccaaattcgagcacctcctggaagattga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101150691
Entry
101150691         CDS       T02442                                 

Gene name
PRKCB
Definition
(RefSeq) protein kinase C beta type isoform X1
  KO
K19662  classical protein kinase C beta type [EC:2.7.11.13]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01521  EGFR tyrosine kinase inhibitor resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04062  Chemokine signaling pathway
ggo04064  NF-kappa B signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04071  Sphingolipid signaling pathway
ggo04150  mTOR signaling pathway
ggo04270  Vascular smooth muscle contraction
ggo04310  Wnt signaling pathway
ggo04370  VEGF signaling pathway
ggo04510  Focal adhesion
ggo04540  Gap junction
ggo04613  Neutrophil extracellular trap formation
ggo04650  Natural killer cell mediated cytotoxicity
ggo04662  B cell receptor signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04670  Leukocyte transendothelial migration
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04727  GABAergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04925  Aldosterone synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04931  Insulin resistance
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04935  Growth hormone synthesis, secretion and action
ggo04960  Aldosterone-regulated sodium reabsorption
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04973  Carbohydrate digestion and absorption
ggo05017  Spinocerebellar ataxia
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05031  Amphetamine addiction
ggo05032  Morphine addiction
ggo05140  Leishmaniasis
ggo05143  African trypanosomiasis
ggo05146  Amoebiasis
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05164  Influenza A
ggo05170  Human immunodeficiency virus 1 infection
ggo05171  Coronavirus disease - COVID-19
ggo05200  Pathways in cancer
ggo05205  Proteoglycans in cancer
ggo05206  MicroRNAs in cancer
ggo05214  Glioma
ggo05223  Non-small cell lung cancer
ggo05225  Hepatocellular carcinoma
ggo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101150691 (PRKCB)
   04012 ErbB signaling pathway
    101150691 (PRKCB)
   04014 Ras signaling pathway
    101150691 (PRKCB)
   04015 Rap1 signaling pathway
    101150691 (PRKCB)
   04310 Wnt signaling pathway
    101150691 (PRKCB)
   04370 VEGF signaling pathway
    101150691 (PRKCB)
   04064 NF-kappa B signaling pathway
    101150691 (PRKCB)
   04066 HIF-1 signaling pathway
    101150691 (PRKCB)
   04020 Calcium signaling pathway
    101150691 (PRKCB)
   04070 Phosphatidylinositol signaling system
    101150691 (PRKCB)
   04071 Sphingolipid signaling pathway
    101150691 (PRKCB)
   04150 mTOR signaling pathway
    101150691 (PRKCB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101150691 (PRKCB)
   04540 Gap junction
    101150691 (PRKCB)
 09150 Organismal Systems
  09151 Immune system
   04613  Neutrophil extracellular trap formation
    101150691 (PRKCB)
   04650 Natural killer cell mediated cytotoxicity
    101150691 (PRKCB)
   04662 B cell receptor signaling pathway
    101150691 (PRKCB)
   04666 Fc gamma R-mediated phagocytosis
    101150691 (PRKCB)
   04670 Leukocyte transendothelial migration
    101150691 (PRKCB)
   04062 Chemokine signaling pathway
    101150691 (PRKCB)
  09152 Endocrine system
   04911 Insulin secretion
    101150691 (PRKCB)
   04929 GnRH secretion
    101150691 (PRKCB)
   04912 GnRH signaling pathway
    101150691 (PRKCB)
   04921 Oxytocin signaling pathway
    101150691 (PRKCB)
   04935 Growth hormone synthesis, secretion and action
    101150691 (PRKCB)
   04918 Thyroid hormone synthesis
    101150691 (PRKCB)
   04919 Thyroid hormone signaling pathway
    101150691 (PRKCB)
   04928 Parathyroid hormone synthesis, secretion and action
    101150691 (PRKCB)
   04916 Melanogenesis
    101150691 (PRKCB)
   04925 Aldosterone synthesis and secretion
    101150691 (PRKCB)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101150691 (PRKCB)
  09154 Digestive system
   04970 Salivary secretion
    101150691 (PRKCB)
   04971 Gastric acid secretion
    101150691 (PRKCB)
   04972 Pancreatic secretion
    101150691 (PRKCB)
   04973 Carbohydrate digestion and absorption
    101150691 (PRKCB)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101150691 (PRKCB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101150691 (PRKCB)
  09156 Nervous system
   04724 Glutamatergic synapse
    101150691 (PRKCB)
   04727 GABAergic synapse
    101150691 (PRKCB)
   04725 Cholinergic synapse
    101150691 (PRKCB)
   04728 Dopaminergic synapse
    101150691 (PRKCB)
   04726 Serotonergic synapse
    101150691 (PRKCB)
   04720 Long-term potentiation
    101150691 (PRKCB)
   04730 Long-term depression
    101150691 (PRKCB)
   04723 Retrograde endocannabinoid signaling
    101150691 (PRKCB)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101150691 (PRKCB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101150691 (PRKCB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101150691 (PRKCB)
   05206 MicroRNAs in cancer
    101150691 (PRKCB)
   05205 Proteoglycans in cancer
    101150691 (PRKCB)
   05231 Choline metabolism in cancer
    101150691 (PRKCB)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101150691 (PRKCB)
   05214 Glioma
    101150691 (PRKCB)
   05223 Non-small cell lung cancer
    101150691 (PRKCB)
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    101150691 (PRKCB)
   05022 Pathways of neurodegeneration - multiple diseases
    101150691 (PRKCB)
  09165 Substance dependence
   05031 Amphetamine addiction
    101150691 (PRKCB)
   05032 Morphine addiction
    101150691 (PRKCB)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101150691 (PRKCB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    101150691 (PRKCB)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101150691 (PRKCB)
   05161 Hepatitis B
    101150691 (PRKCB)
   05171 Coronavirus disease - COVID-19
    101150691 (PRKCB)
   05164 Influenza A
    101150691 (PRKCB)
   05163 Human cytomegalovirus infection
    101150691 (PRKCB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101150691 (PRKCB)
   05140 Leishmaniasis
    101150691 (PRKCB)
   05143 African trypanosomiasis
    101150691 (PRKCB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101150691 (PRKCB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101150691 (PRKCB)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     101150691 (PRKCB)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   101150691 (PRKCB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 C2 Pkinase_C C1_2 Kinase-like CEP76-C2 APH
Other DBs
NCBI-GeneID: 101150691
NCBI-ProteinID: XP_018867962
UniProt: G3R5W0
LinkDB
Position
16
AA seq 673 aa
MADPAAGPPPSEGEESTVRFARKGALRQKNVHEVKNHKFTARFFKQPTFCSHCTDFIWGF
GKQGFQCQVCCFVVHKRCHEFVTFSCPGADKGPASDDPRSKHKFKIHTYSSPTFCDHCGS
LLYGLIHQGMKCDTCMMNVHKRCVMNVPSLCGTDHTERRGRIYIQAHIDRDVLIVLVRDA
KNLVPMDPNGLSDPYVKLKLIPDPKSESKQKTKTIKCSLNPEWNETFRFQLKESDKDRRL
SVEIWDWDLTSRNDFMGSLSFGISELQKASVDGWFKLLSQEEGEYFNVPVPPEGSEANEE
LRQKFERAKISQGTKVPEEKTTNTVSKFDNNGNRDRMKLTDFNFLMVLGKGSFGKVMLSE
RKGTDELYAVKILKKDVVIQDDDVECTMVEKRVLALPGKPPFLTQLHSCFQTMDRLYFVM
EYVNGGDLMYHIQQVGRFKEPHAVFYAAEIAIGLFFLQSKGIIYRDLKLDNVMLDSEGHI
KIADFGMCKENIWDGVTTKTFCGTPDYIAPEIIAYQPYGKSVDWWAFGVLLYEMLAGQAP
FEGEDEDELFQSIMEHNVAYPKSMSKEAVAICKGLMTKHPGKRLGCGPEGERDIKEHAFF
RYIDWEKLERKEIQPPYKPKACGRNAENFDRFFTRHPPVLTPPDQEVIRNIDQSEFEGFS
FVNSEFLKPEVKS
NT seq 2022 nt   +upstreamnt  +downstreamnt
atggctgacccggctgcggggccgccgccgagcgagggcgaggagagcaccgtgcgcttc
gcccgcaaaggcgccctccggcagaagaacgtgcatgaggtcaagaaccacaaattcacc
gcccgcttcttcaagcagcccaccttctgcagccactgcaccgacttcatctggggcttc
gggaagcagggattccagtgccaagtttgctgctttgtggtgcacaagcggtgccatgaa
tttgtcacattctcctgccctggcgctgacaagggtccagcctctgatgacccccggagc
aaacacaagtttaagatccacacgtactccagccccacgttttgtgaccactgtgggtca
ctgctgtatggactcatccaccaggggatgaaatgtgacacctgcatgatgaatgtgcac
aagcgctgcgtgatgaatgttcccagcctgtgtggcacggaccacacggagcgccgcggc
cgcatctacatccaggcccacatcgacagggacgtcctcattgtcctcgtaagagatgct
aaaaaccttgtacctatggaccccaatggcctgtcagatccctacgtaaaactgaaactg
attcccgatcccaaaagtgagagcaaacagaagaccaaaaccatcaaatgctccctcaac
cctgagtggaatgagacatttagatttcagctgaaagaatcggacaaagacagaagactg
tcagtagagatttgggactgggatttgaccagcaggaatgacttcatgggatctttgtcc
tttgggatttctgaacttcagaaagccagtgttgatggctggtttaagttactgagccag
gaggaaggcgagtacttcaatgtgcctgtgccaccagaaggaagtgaggccaatgaagaa
ctgcggcagaaatttgagagggccaagatcagtcagggaaccaaggtcccggaagaaaag
acgaccaacactgtctccaaatttgacaacaatggcaacagagaccggatgaaactgacc
gattttaacttcctaatggtgctggggaaaggcagctttggcaaggtcatgctttcagaa
cgaaaaggcacagatgagctctatgctgtgaagatcctgaagaaggacgttgtgatccaa
gatgatgacgtggagtgcactatggtggagaagcgggtgttggccctgcccgggaagcca
cccttcctgacccagctccactcctgcttccagaccatggaccgcctgtactttgtgatg
gagtacgtgaatgggggcgacctcatgtatcacatccagcaagtcggccggttcaaggag
ccccatgctgtattttacgccgcagaaattgccatcggtctgttcttcttacagagtaag
ggcatcatttaccgtgacctaaaacttgacaacgtgatgctcgattctgagggacacatc
aagattgccgattttggcatgtgtaaggaaaacatctgggatggggtgacaaccaagaca
ttctgtggcactccagactacatcgcccccgagataattgcttatcagccctatgggaag
tccgtggattggtgggcatttggagtcctgctgtatgaaatgttggctgggcaggcaccc
tttgaaggggaggatgaagatgaactcttccaatccatcatggaacacaacgtagcctat
cccaagtctatgtccaaggaagctgtggccatctgcaaagggctgatgaccaaacacccg
ggcaaacgtctgggttgtggacctgaaggcgaacgtgatatcaaagagcatgcatttttc
cggtatattgattgggagaaacttgaacgcaaagagatccagcccccatataagccaaaa
gcttgtgggcgaaatgctgaaaacttcgaccgatttttcacccgccatccaccagtccta
acacctcccgaccaggaagtcatcaggaatattgaccaatcagaattcgaaggattttcc
tttgttaactctgaatttttaaaacccgaagtcaagagctaa

DBGET integrated database retrieval system