KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101124928
Entry
101124928         CDS       T02442                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X2
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01521  EGFR tyrosine kinase inhibitor resistance
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04144  Endocytosis
ggo04151  PI3K-Akt signaling pathway
ggo04510  Focal adhesion
ggo04540  Gap junction
ggo04630  JAK-STAT signaling pathway
ggo04810  Regulation of actin cytoskeleton
ggo05163  Human cytomegalovirus infection
ggo05200  Pathways in cancer
ggo05206  MicroRNAs in cancer
ggo05214  Glioma
ggo05215  Prostate cancer
ggo05218  Melanoma
ggo05230  Central carbon metabolism in cancer
ggo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101124928 (PDGFRA)
   04014 Ras signaling pathway
    101124928 (PDGFRA)
   04015 Rap1 signaling pathway
    101124928 (PDGFRA)
   04630 JAK-STAT signaling pathway
    101124928 (PDGFRA)
   04020 Calcium signaling pathway
    101124928 (PDGFRA)
   04072 Phospholipase D signaling pathway
    101124928 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    101124928 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101124928 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101124928 (PDGFRA)
   04540 Gap junction
    101124928 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101124928 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101124928 (PDGFRA)
   05206 MicroRNAs in cancer
    101124928 (PDGFRA)
   05230 Central carbon metabolism in cancer
    101124928 (PDGFRA)
   05231 Choline metabolism in cancer
    101124928 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    101124928 (PDGFRA)
   05218 Melanoma
    101124928 (PDGFRA)
   05215 Prostate cancer
    101124928 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101124928 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101124928 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101124928 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ggo04090]
    101124928 (PDGFRA)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101124928 (PDGFRA)
Protein kinases [BR:ggo01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   101124928 (PDGFRA)
CD molecules [BR:ggo04090]
 Proteins
  101124928 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 V-set Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 101124928
NCBI-ProteinID: XP_004038732
Ensembl: ENSGGOG00000010615
UniProt: G3R4Z2
LinkDB
Position
4
AA seq 1089 aa
MGTSHPAFLVLGCLLTGLSLILCQLSLPSILPNENEKVVQLNSSFSLRCFGESEVSWQYP
MSEEENSDVEIRNEENNSGLFVTVLEVSSASAAHTGLYTCYYNHTQTDENELEGRHIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETAVTLHNSEGVVPASYDSRQGFNG
TFTVGPYICEATVKGKKFQTIPFNVYALKATSELDLEMEALKTVYKSGETIVVTCAVFNN
EVVDLQWTYPGEVKGKGITMLEEIKIPSIKLVYTLTVPEATVKDSGDYECAARQATREVK
EMKKVTISVHEKGFIEIKPTFSQLEAVNLHEVKHFVVEVRAYPPPRISWLKNNLTLIENL
TEITTDVEKIQEIRYRSKLKLIRAKEEDSGHYTIVAQNEDAVKSYTFELLTQVPSSILDL
VDDHHGSTGGQTVRCIAEGTPLPDIEWMICKDIKKCNNETSWTILANNVSNIITEIHPRD
RSTVEGRVTFAKVEETIAVRCLAKNLLGAENRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSHHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRSLYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSDNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccatccggcgttcctggtcttaggctgtcttctcacagggctgagccta
atcctctgccagctttcattaccctctatccttccaaatgaaaatgaaaaggttgtgcag
ctgaattcatccttttctctgagatgctttggggagagtgaagtgagctggcagtacccc
atgtctgaagaagagaactccgatgtggaaatcagaaatgaagaaaacaacagtggcctt
tttgtgacggtcttggaagtgagcagtgcctcggcggcccacacagggttgtacacttgc
tattacaaccacactcagacagacgagaatgagcttgaaggcaggcacatttacatctat
gtgccagacccagatgtagcctttgtacctctaggaatgacggattatttagtcatcgtg
gaggatgatgattctgccattataccttgtcgcacaactgatcccgagactgctgtaacc
ttacacaacagtgagggggtggtacctgcctcctacgacagcagacagggctttaatggg
accttcactgtagggccctatatctgtgaggccaccgtcaaaggaaagaagttccagacc
atcccatttaacgtttatgctttaaaagcaacatcagagctggatctagaaatggaagct
cttaaaaccgtgtataagtcaggggaaacgattgtggtcacctgtgctgtttttaacaat
gaggtggttgaccttcaatggacttaccctggagaagtgaaaggcaaaggcatcacaatg
ctggaagaaatcaaaatcccatccatcaaattggtgtacactttgacggtccccgaggcc
acggtgaaagacagtggagattacgaatgtgctgcccgccaggctaccagggaggtcaaa
gaaatgaagaaagtcactatttctgtccatgagaaagggttcattgaaatcaaacccacc
ttcagccagttggaagctgtcaacctgcatgaagtcaaacattttgttgtagaggtgcgg
gcctacccacctcctaggatatcctggctgaaaaacaatctgactctgattgaaaatctc
actgagatcaccactgatgtggaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgtgctaaggaagaagacagtggccattatactattgtagctcaaaatgaagat
gctgtgaagagctatacttttgaactgttaactcaagttccttcatccattctggacttg
gtcgatgatcaccatggctcaactgggggacagacggtgaggtgcatagctgaaggcacg
ccgcttcctgatattgagtggatgatatgcaaagatattaagaaatgtaataatgaaact
tcctggacgattttggccaacaatgtctcaaacatcatcacggagatccacccccgagac
aggagtaccgtggagggccgtgtgactttcgccaaagtggaggagaccatcgcggtgcga
tgcctggctaagaatctccttggagctgagaaccgagagctgaagctggtggctcccacc
ctgcgttctgaactcacggtggctgctgcagtcctggtgctgttggtgattgtgatcatc
tcacttattgtcctggttgtcatttggaaacagaaaccgaggtatgaaattcgctggagg
gtcattgaatcaatcagcccggatggacatgaatatatttatgtggacccgatgcagctg
ccttatgactcaagatgggagtttccaagagatggactagtgcttggtcgggtcttgggg
tctggagcgtttgggaaggtggttgaaggaacagcctatggattaagccggtcccaacct
gtcatgaaagttgcagtgaagatgctaaaacccacggccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgactcacctggggccacatttgaacattgtaaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcacagagtactgcttctatgga
gatttggtcaactatttgcataagaatagggatagcttcctgagccaccacccagagaag
ccaaagaaagagctggatatctttggattgaaccctgctgatgaaagcacacggagctat
gttattttatcttttgaaaacaatggtgactacatggacatgaagcaggctgatactaca
cagtatgtccccatgctagaaaggaaagaggtttctaaatattccgacatccagagatca
ctctatgatcgtccagcctcatataagaagaaatctatgttagactcagaagtcaaaaac
ctcctttcagatgataactcagaaggccttactttattggatttgttgagcttcacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgtgatctggct
gctcgcaacgtcctcctggcacaaggaaaaatcgtgaagatctgtgactttggcctggcc
agagacatcatgcatgattcgaactatgtgtcgaaaggcagtacctttctgcccgtgaag
tggatggctcctgagagcatctttgacaacctctacaccacactgagtgatgtctggtct
tacggcattctgctctgggagatcttttcccttggtggcaccccttaccccggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gctaccagtgaagtctacgagatcatggtgaaatgctggaacagtgagccggagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcctggacaatataaaaag
agttatgaaaaaattcacctggacttcctgaagagtgaccatcctgctgtggcacgcatg
cgtgtggactcagacaatgcatacattggtgtcacctacaaaaacgaggaagacaagctg
aaggactgggagggtggtctggatgagcagagactgagcgctgacagtggctacatcatt
cctctgcctgacattgaccctgtccctgaggaggaggacctgggcaagaggaacagacac
agctcgcagacctctgaagagagtgccattgagacgggttccagcagttccaccttcatc
aagagagaggacgagaccattgaagacatcgacatgatggacgacatcggcatagactct
tcagacctggtggaagacagcttcctgtaa

DBGET integrated database retrieval system