KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125149
Entry
101125149         CDS       T02442                                 

Gene name
TMEM25
Definition
(RefSeq) transmembrane protein 25 isoform X3
  KO
K22652  transmembrane protein 25
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ggo04515]
    101125149 (TMEM25)
Cell adhesion molecules [BR:ggo04515]
 Immunoglobulin superfamily
  TMEM25
   101125149 (TMEM25)
SSDB
Motif
Pfam: C2-set_2 Ig_3 I-set
Other DBs
NCBI-GeneID: 101125149
NCBI-ProteinID: XP_004052276
Ensembl: ENSGGOG00000000953
UniProt: G3RVV3
LinkDB
Position
11
AA seq 366 aa
MALPPGPAALRHTLLLLPALLSSGWGELEPQIDGQTWAERALRENERHAFTCRVAGGPGT
PRLAWYLDGQLQEASTSRLLSVGGEAFSGGTSTFTVTAHRAQHELNCSLQDPSSGRSANA
SVILNVQFKPEIAQVGAKYQEAQGPGLLVVLFALVRANPPANVTWIDQDGPVTVNTSDFL
VLDAQNYPWLTNHTVQLQLRSLAHNLSVVATNDVGVTSASLPAPGLLATRVEVPLLGIIV
AAGLALGTLVGFSTLVACLVCRKEKKTKGPSRRPSLISSDSNNLKLNNVRLPRENMSLPS
NLQLNDLTPDSRAVKPADRQMAQNNSRPELLDPEPGGLLTSRGFIRLPMLGYIYRVSSVS
SDEIWL
NT seq 1101 nt   +upstreamnt  +downstreamnt
atggcgctgcctccgggcccagccgccctccggcacacactgctgctcctgccagccctt
ctgagctcaggttggggggagttggagccacaaatagatggtcagacctgggctgagcgg
gcacttcgggagaatgaacgccacgccttcacctgccgggtggcagggggacctggcacc
cccagattggcctggtatctggatggacagctgcaggaggccagcacctcaagactgctg
agcgtgggaggggaggccttctctggaggcaccagcaccttcactgtcactgcccatcgg
gcccagcatgagctcaactgctccctgcaggaccccagcagtggccgatcagccaacgcc
tctgtcatccttaatgtgcaattcaagccagagattgcccaagtcggcgccaagtaccag
gaagctcagggcccaggcctcctggttgtcctgtttgccctggtgcgtgccaacccgcct
gccaatgtcacctggatcgaccaggatgggccagtgactgtcaacacctctgacttcctg
gtgctggatgcgcagaactacccctggctcaccaaccacacggtgcagctgcagctccgc
agcctggcacacaacctctcggtggtggccaccaatgacgtgggtgtcaccagtgcgtcg
cttccagccccagggcttctggctacccgggtggaagtgccactgctgggcattattgtg
gctgctgggcttgccctgggcaccctcgtggggttcagcaccttggtggcctgcctggtc
tgcagaaaagagaagaaaaccaaaggcccctcccggcgcccatctctgatatcaagtgac
tccaacaacctaaaactcaacaacgtgcgcctgccacgggagaacatgtccctcccgtcc
aaccttcagctcaatgacctcactccagattccagagcagtgaaaccagcagaccggcag
atggctcagaacaacagccggccagagcttctggacccggagcccggcggcctcctcacc
agccgaggtttcatccgcctcccaatgctgggctatatctatcgagtgtccagcgtgagc
agtgatgagatctggctctga

DBGET integrated database retrieval system