KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125890
Entry
101125890         CDS       T02442                                 

Gene name
ADCY4
Definition
(RefSeq) adenylate cyclase type 4 isoform X1
  KO
K08044  adenylate cyclase 4 [EC:4.6.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00230  Purine metabolism
ggo01100  Metabolic pathways
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04727  GABAergic synapse
ggo04742  Taste transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05032  Morphine addiction
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101125890 (ADCY4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101125890 (ADCY4)
   04371 Apelin signaling pathway
    101125890 (ADCY4)
   04020 Calcium signaling pathway
    101125890 (ADCY4)
   04072 Phospholipase D signaling pathway
    101125890 (ADCY4)
   04024 cAMP signaling pathway
    101125890 (ADCY4)
   04022 cGMP-PKG signaling pathway
    101125890 (ADCY4)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101125890 (ADCY4)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101125890 (ADCY4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101125890 (ADCY4)
   04062 Chemokine signaling pathway
    101125890 (ADCY4)
  09152 Endocrine system
   04911 Insulin secretion
    101125890 (ADCY4)
   04923 Regulation of lipolysis in adipocytes
    101125890 (ADCY4)
   04912 GnRH signaling pathway
    101125890 (ADCY4)
   04913 Ovarian steroidogenesis
    101125890 (ADCY4)
   04915 Estrogen signaling pathway
    101125890 (ADCY4)
   04914 Progesterone-mediated oocyte maturation
    101125890 (ADCY4)
   04921 Oxytocin signaling pathway
    101125890 (ADCY4)
   04926 Relaxin signaling pathway
    101125890 (ADCY4)
   04935 Growth hormone synthesis, secretion and action
    101125890 (ADCY4)
   04918 Thyroid hormone synthesis
    101125890 (ADCY4)
   04928 Parathyroid hormone synthesis, secretion and action
    101125890 (ADCY4)
   04916 Melanogenesis
    101125890 (ADCY4)
   04925 Aldosterone synthesis and secretion
    101125890 (ADCY4)
   04927 Cortisol synthesis and secretion
    101125890 (ADCY4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101125890 (ADCY4)
   04270 Vascular smooth muscle contraction
    101125890 (ADCY4)
  09154 Digestive system
   04970 Salivary secretion
    101125890 (ADCY4)
   04971 Gastric acid secretion
    101125890 (ADCY4)
   04972 Pancreatic secretion
    101125890 (ADCY4)
   04976 Bile secretion
    101125890 (ADCY4)
  09156 Nervous system
   04724 Glutamatergic synapse
    101125890 (ADCY4)
   04727 GABAergic synapse
    101125890 (ADCY4)
   04725 Cholinergic synapse
    101125890 (ADCY4)
   04723 Retrograde endocannabinoid signaling
    101125890 (ADCY4)
  09157 Sensory system
   04742 Taste transduction
    101125890 (ADCY4)
   04750 Inflammatory mediator regulation of TRP channels
    101125890 (ADCY4)
  09149 Aging
   04211 Longevity regulating pathway
    101125890 (ADCY4)
   04213 Longevity regulating pathway - multiple species
    101125890 (ADCY4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101125890 (ADCY4)
   04714 Thermogenesis
    101125890 (ADCY4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101125890 (ADCY4)
  09165 Substance dependence
   05032 Morphine addiction
    101125890 (ADCY4)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101125890 (ADCY4)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101125890 (ADCY4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101125890 (ADCY4)
   05163 Human cytomegalovirus infection
    101125890 (ADCY4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101125890 (ADCY4)
Enzymes [BR:ggo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101125890 (ADCY4)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N DUF3180 CD52
Other DBs
NCBI-GeneID: 101125890
NCBI-ProteinID: XP_018865769
Ensembl: ENSGGOG00000004700
UniProt: G3QPV5
LinkDB
Position
14
AA seq 1077 aa
MARLFSPRPPPSEDLFYETYYSLSQQYPLLLLLLGIVLCALAALLAVAWASGRELTSDPS
FLTTVLCALGGFSLLLGLASREQRLQRWTRPLSGLVWVALLALGHAFLFTGGVVSAWDQV
SYFLFVIFTAYAMLPLGMRDAAVAGLASSLSHLLVLGLYLGPQPDSRPALLPQLAANAVL
FLCGNVAGVYHKALMERALRATFREALSSLHSRRRLDTEKKHQEHLLLSILPAYLAREMK
AEIMARLQAGQGSRPESTNNFHSLYVKRHQGVSVLYADIVGFTRLASECSPKELVLMLNE
LFGKFDQIAKEHECMRIKILGDCYYCVSGLPLSLPDHAINCVRMGLDMCRAIRKLRAATG
VDINMRVGVHSGSVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITGATLALLAG
AYAVEDAGMEHRDPYLRELGEPTYLVIDPRAEEEDEKGTAGGLLSSLEGLKMRPSLLMTR
YLESWGAAKPFAHLSHGDSPVSTSTPLPEKTLASFSTQWSLDRSRTPRGLDDELDTGDAK
FFQVIEQLNSQKQWKQSKDFNPLTLYFREKEMEKEYRLSAIPAFKYYEACTFLVFLSNFI
IQMLVTNRPPALVITYSITFLLFLLILFVCFSEDLMRCVLKGPKMLHWLPALSGLVATRP
GLRIALGTATILLVFAMAITSLFFFPTSSDCPFQAPNVSSMISNLSWELPGSLPLISVPY
SMHCCTLGFLSCSLFLHMSFELKLLLLLLWLAASCSLFLHSHAWLSECLIVRLYLGALDS
RPGVLKEPKLMGAISFFIFFFTLLVLARQNEYYCRLDFLWKKKLRQEREETETMENLTRL
LLENVLPAHVAPQFIGQNRRNEDLYHQSYECVCVLFASVPDFKEFYSESNINHEGLECLR
LLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNATSGQDAQQDAERSCSHLGTMV
EFAVALGSKLDVINKHSFNNFRLRVGLNHGPVVAGVIGAQKPQYDIWGNTVNVASRMEST
GVLGKIQVTEETAWALQSLGYTCYSRGVIKVKGKGQLCTYFLNTDLTRTGPPSATLG
NT seq 3234 nt   +upstreamnt  +downstreamnt
atggcccgcctcttcagcccccggccgccccccagcgaagacctcttctacgagacctac
tacagcctgagccagcagtacccgctgctgctgctgctgctggggatcgtgctctgtgcg
ctcgcggcgctgctcgccgtggcctgggccagcggcagggagctgacctcagacccgagc
ttcctgaccactgtgctgtgcgcgctgggcggcttctcgctgctgctgggcctcgcttcc
cgggagcagcgactgcagcgctggacgcgtcccctgtccggcttggtatgggtcgcgctg
ctagcgctaggccacgccttcctgttcaccgggggcgtggtgagcgcctgggaccaggtg
tcctattttctcttcgtcatcttcacggcgtatgccatgctgcccttgggcatgcgggac
gccgccgtcgcgggcctcgcctcctcactctcgcatctgctggtcctcgggctgtatctt
gggccacagccggactcacggcctgcactgctgccgcagttggcagcaaacgcagtgctg
ttcctgtgcgggaacgtggcaggagtgtaccacaaggcgctgatggagcgcgccctgcgg
gccacgttccgggaggcactcagctccctgcactcacgccggcggctggacaccgagaag
aagcaccaggaacaccttctcttgtccatccttcctgcctacctggcccgagagatgaag
gcagagatcatggcacggctgcaggcaggacaggggtcacggccagagagcactaacaat
ttccacagcctctatgtcaagaggcaccagggagtcagcgtgctgtatgctgacatcgtg
ggcttcacgcggctggccagcgagtgttcccctaaggagctggtgctcatgctcaatgag
ctctttggcaagttcgaccagattgccaaggagcatgaatgcatgcggatcaagatcctg
ggggactgttactactgtgtctctgggctgccactctcactgccagaccatgccatcaac
tgcgtgcgcatgggcctggacatgtgccgggccatcaggaaactgcgggcagccactggc
gtggacatcaacatgcgtgtgggcgtgcactcaggcagcgtactgtgtggagtcatcggg
ctgcagaagtggcagtacgacgtttggtcccatgatgtcacactggctaaccacatggag
gcaggcggtgtaccagggcgagtgcacatcacaggggctaccctggccctgctggcaggg
gcttatgctgtggaggatgcaggcatggagcatcgggacccctaccttcgggagctaggg
gagcctacctatctggtcatcgatccacgggcagaggaggaggatgagaagggcactgca
ggaggcttgctgtcctcgcttgagggcctcaagatgcgtccatcactgctgatgacccgt
tacctggagtcctggggcgcagccaagccttttgcccacctgagccacggagacagccct
gtgtccacctccacccctctcccggagaagaccctggcttccttcagcacccagtggagc
ctggatcggagccgtaccccccggggactagatgatgaactggacaccggggatgccaag
ttcttccaggtcattgagcagctcaactcgcagaaacagtggaagcagtcgaaggacttc
aaccccctgacactgtacttcagagagaaggagatggagaaagagtaccgactctctgca
atccccgccttcaaatactatgaagcctgcaccttcctggtttttctctccaacttcatc
atccagatgctagtgacaaacaggcccccagctctggtcatcacgtatagcatcaccttc
ctcctcttcctcctcatcctttttgtctgcttctcagaggacctgatgaggtgtgtcctg
aaaggccccaagatgctgcactggctgcctgcactgtctggcctggtggccacacgacca
ggactgagaatagccttgggcaccgccaccatcctccttgtctttgccatggccattacc
agcctgttcttcttcccaacatcatcagactgccctttccaagctcccaatgtgtcctcc
atgatttccaacctctcctgggagctccctgggtctctacctctcatcagtgtcccatac
tccatgcactgctgcacgctgggcttcctctcctgctccctctttctgcacatgagcttc
gagctgaagctgctgctgctcctgctgtggctggcggcatcctgctccctcttcctgcac
tcccacgcctggctgtccgaatgcctcatcgtccgcctctatctgggcgccttggactcc
aggcccggagtgctgaaggagcccaaactgatgggtgctatctccttcttcatcttcttc
ttcaccctccttgtcctggctcgccagaatgagtactactgccgcctggacttcctgtgg
aagaagaagctgaggcaggagcgggaggagacagagacgatggagaacctgactcggctg
ctcttggagaacgtgctccctgcacacgtggccccccagttcattggccagaaccggcgc
aacgaggatctctaccaccagtcctatgaatgcgtttgtgtcctcttcgcctcagtccca
gacttcaaggagttctactctgaatccaacatcaatcatgagggcctagagtgtctgagg
ctgctcaatgagataattgctgattttgatgagctgctctccaagcccaagttcagtggg
gtggagaagatcaagaccatcggcagcacctacatggcagccacaggcttaaatgccacc
tctggacaggatgcacaacaggatgctgaacggagctgcagccaccttggcactatggtg
gaatttgccgtggccctggggtctaagctggacgtcatcaacaagcattcattcaacaac
ttccgcctgcgtgtggggttgaaccatggaccagtagtagctggagttattggggcccag
aagccgcaatatgacatttggggcaacacagtgaacgtggccagccgcatggagagtacc
ggagtccttggcaaaatccaagtgactgaggagacagcatgggccctacagtccctgggc
tacacctgctacagccggggtgtcatcaaggtgaaaggcaaagggcagctctgcacctac
ttcctgaacacagacttgacacgaactggacctccttcagctaccctaggctga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101125943
Entry
101125943         CDS       T02442                                 

Gene name
ADCY1
Definition
(RefSeq) adenylate cyclase type 1
  KO
K08041  adenylate cyclase 1 [EC:4.6.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00230  Purine metabolism
ggo01100  Metabolic pathways
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04727  GABAergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05032  Morphine addiction
ggo05142  Chagas disease
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101125943 (ADCY1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101125943 (ADCY1)
   04371 Apelin signaling pathway
    101125943 (ADCY1)
   04020 Calcium signaling pathway
    101125943 (ADCY1)
   04072 Phospholipase D signaling pathway
    101125943 (ADCY1)
   04024 cAMP signaling pathway
    101125943 (ADCY1)
   04022 cGMP-PKG signaling pathway
    101125943 (ADCY1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101125943 (ADCY1)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101125943 (ADCY1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101125943 (ADCY1)
   04062 Chemokine signaling pathway
    101125943 (ADCY1)
  09152 Endocrine system
   04911 Insulin secretion
    101125943 (ADCY1)
   04923 Regulation of lipolysis in adipocytes
    101125943 (ADCY1)
   04912 GnRH signaling pathway
    101125943 (ADCY1)
   04913 Ovarian steroidogenesis
    101125943 (ADCY1)
   04915 Estrogen signaling pathway
    101125943 (ADCY1)
   04914 Progesterone-mediated oocyte maturation
    101125943 (ADCY1)
   04921 Oxytocin signaling pathway
    101125943 (ADCY1)
   04926 Relaxin signaling pathway
    101125943 (ADCY1)
   04935 Growth hormone synthesis, secretion and action
    101125943 (ADCY1)
   04918 Thyroid hormone synthesis
    101125943 (ADCY1)
   04928 Parathyroid hormone synthesis, secretion and action
    101125943 (ADCY1)
   04916 Melanogenesis
    101125943 (ADCY1)
   04925 Aldosterone synthesis and secretion
    101125943 (ADCY1)
   04927 Cortisol synthesis and secretion
    101125943 (ADCY1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101125943 (ADCY1)
   04270 Vascular smooth muscle contraction
    101125943 (ADCY1)
  09154 Digestive system
   04970 Salivary secretion
    101125943 (ADCY1)
   04971 Gastric acid secretion
    101125943 (ADCY1)
   04972 Pancreatic secretion
    101125943 (ADCY1)
   04976 Bile secretion
    101125943 (ADCY1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101125943 (ADCY1)
   04727 GABAergic synapse
    101125943 (ADCY1)
   04725 Cholinergic synapse
    101125943 (ADCY1)
   04720 Long-term potentiation
    101125943 (ADCY1)
   04723 Retrograde endocannabinoid signaling
    101125943 (ADCY1)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101125943 (ADCY1)
  09149 Aging
   04211 Longevity regulating pathway
    101125943 (ADCY1)
   04213 Longevity regulating pathway - multiple species
    101125943 (ADCY1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101125943 (ADCY1)
   04714 Thermogenesis
    101125943 (ADCY1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101125943 (ADCY1)
  09165 Substance dependence
   05032 Morphine addiction
    101125943 (ADCY1)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101125943 (ADCY1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101125943 (ADCY1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101125943 (ADCY1)
   05163 Human cytomegalovirus infection
    101125943 (ADCY1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101125943 (ADCY1)
   05142 Chagas disease
    101125943 (ADCY1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101125943 (ADCY1)
Enzymes [BR:ggo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101125943 (ADCY1)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053
Other DBs
NCBI-GeneID: 101125943
NCBI-ProteinID: XP_030869238
Ensembl: ENSGGOG00000010304
LinkDB
Position
7
AA seq 1293 aa
MAGAPRGGGGGGGGAGEPGGAERAAGPSRRRGLRACDEEFACPELEALFRGYTLRLEQAA
TLKALAVLSLLAGALALAELLGAPGPAPGLAKGSHPVHCVLFLALLVVTNVRSLQVPQLQ
QVGQLALLFSLTFALLCCPFALGGPARGSAGAAGGPATAEQGVWQLLLVTFVSYALLPVR
SLLAIGFGLVVAASHLLVTATLVPAKRPRLWRTSRLAPSGQGSLQSYNPRSAPGVKCGEG
RQVWREKGLAKVRELMSGQTAARGVRRSFAAPIPTEGVKVGEESGPPGQAPRPALRAALG
SSPAHLERVLGSPPSPADPRGVYGCRAGEMVARTGTLSACRGLFLGPGGARSSNCPEVDV
DQRSLPHGGALRASPCAHLQRAAGMGLGSGGWGDMEDPEEGFVSASSCSLAGGWYDSNGV
GEPISRKEAVVGANWGEERLLMSLLPRNVAMEMKEDFLKPPERIFHKIYIQRHDNVSILF
ADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTD
HAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLA
NVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLKTHNIETFFIVPSHRRKIFP
GLILSDIKPAKRMKFKTVCYLLVQLMHCRKMFKAEIPFSNVMTCEDDDKRRALRTASEKL
RNRSSFSTNVVYTTPGTRVNRYISRLLEARQTELEMADLNFFTLKYKHVEREQKYHQLQD
EYFTSAVVLTLILAALFGLVYLLIFPQSVVVLLLLVFCICFLVACVLYLHITRVQCFPGC
LTIQIRTVLCIFIVVLIYSVAQGCVVGCLPWAWSSKPNSSLVVLSSGGQRTALPTLPCES
THHALLCCLVGTLPLAIFFRVSSLPKMILLSGLTTSYILVLELSGYTRTGGGAVSGRSYE
PIVAILLFSCALALHARQVDIRLRLDYLWAAQAEEEREDMEKVKLDNRRILFNLLPAHVA
QHFLMSNPRNMDLYYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDE
LMEKDFYKDIEKIKTIGSTYMAAVGLAPTSGTKAKKSISSHLSTLADFAIEMFDVLDEIN
YQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGRIQVTEEVHR
LLRRCPYHFVCRGKVSVKGKGEMLTYFLEGRTDGNGSQIRSLGLDRKMCPFGRAGLQGRR
PPVCPMPGVSVRAGLPPHSPGQYLPSAAAGKEA
NT seq 3882 nt   +upstreamnt  +downstreamnt
atggcgggggcgccgcgcggcggaggcggcggcggaggcggcgcgggcgagcccgggggc
gccgagcgggcggccgggccaagccgccggcgcgggctccgggcgtgcgacgaggagttc
gcttgcccagagctggaggcgctgttccgcggctacacgctgcggctggagcaggcggcc
acgctgaaggcgctggccgttctcagcctgctggcgggcgcgctggcgctggccgagctg
ctgggcgcgccggggcccgcgcccggcctggccaagggctcacacccggtgcactgcgtc
ctcttcctggcgctgctggtggtaaccaacgtccggtccctgcaggtgccccagctgcag
caggtcggccagctggcgctgctcttcagcctcaccttcgcgctgctctgctgtcctttc
gcgctgggcggccccgcccggggttccgccggggccgctggggggccagcgaccgccgaa
caaggggtttggcagctccttttggtcaccttcgtgtcctatgccttgctgcccgtgcgc
agcctgctggccatcggctttgggctcgtggtggctgcgtcgcacttgctggtcacagcc
accttggtccccgccaagcgcccacgtctctggaggacgtcgcggctggcaccctccggc
cagggctctcttcagagttacaatccacgaagcgcccctggcgtgaagtgtggagagggg
agacaggtgtggagagagaaaggtttggccaaggtcagggagctgatgagcggccagacg
gcggccagaggggtccgccggtcttttgccgcacccatccccacagagggcgtgaaagtg
ggcgaggagagcggacccccagggcaagctccaaggccggctctgcgcgcagcgctgggc
tcttcccctgcgcacctagagcgcgtgctgggctcgcctcccagccctgcggacccgagg
ggagtatatgggtgtcgggcgggcgagatggttgcaaggacggggacgctgtctgcctgc
cgcggactcttcctgggccctggaggagcccgctcttccaactgcccggaggtggacgtg
gaccagaggtctttgccccacggcggggctttgagagcttccccttgtgcccatctccaa
cgggccgcggggatggggctggggagtggggggtggggagatatggaagaccctgaggag
ggttttgtttctgcctctagctgcagtttagcagggggatggtatgactcaaatggagtg
ggggagcccatctcacgaaaggaagcagtggtgggagcaaattggggagaggagcggctc
ctcatgagcctcctgccccggaacgttgccatggagatgaaggaggacttcctgaagccc
cctgagaggattttccacaagatttacatccaaaggcacgacaatgtgagcatcctgttt
gctgacatcgtgggtttcacgggcttggcatcccagtgcacagcccaggagctggtgaaa
ctcctcaatgagctcttcggcaagttcgatgaattagccacggagaaccactgtcgccgc
atcaagattcttggggactgctactactgtgtgtcgggcctcacccagcccaagactgac
catgcccactgctgtgtggagatggggctcgacatgattgataccatcacatctgtggct
gaagccaccgaggtggatctgaacatgcgtgtgggtctgcacacgggcagggtcctctgt
ggtgtcctgggcttgcgcaagtggcagtacgacgtgtggtccaatgatgtgaccttggcc
aatgtcatggaagccgctggcctgccagggaaggttcatatcacaaagacgaccctagcg
tgcttgaatggggactacgaggtagaaccgggttacggacatgagaggaacagtttcttg
aaaactcataacatcgaaaccttttttattgtgccatcccatcgccgaaagatatttcca
ggcctgattctctcagatataaaaccggccaaaaggatgaagttcaagactgtctgctac
ctgctggtgcagctcatgcactgccggaaaatgttcaaggccgagatccccttctccaac
gtcatgacctgcgaggacgatgacaagcggagggcattaagaacagcctcggaaaaactc
agaaaccgctcatctttttctaccaacgttgtctacaccaccccgggcactcgtgtcaac
aggtacatcagccgcctcttagaagcccgccagacagagctggagatggcagacctgaac
ttctttaccctgaagtacaaacatgttgaacgggagcaaaagtaccaccagcttcaggac
gagtatttcaccagcgccgttgtcctcaccctcatcctggctgccttatttggccttgtc
taccttctaatattcccacagagtgtggtcgtcctgctcctgctagtattctgcatctgc
ttcctggtggcctgtgtcctgtacctgcacatcacccgggtccagtgttttccagggtgc
ctgacgattcagattcgcactgtcctgtgtattttcatagtggtcttaatctactcagta
gcccaaggttgtgtggtgggctgcctgccttgggcctggagctccaagcccaacagttcc
ctggtggtcctttcgtctgggggccagcgcacagccctgcccaccctgccctgcgagtct
acacaccatgccctgctctgctgcctggtaggcaccctcccgctagccatatttttccgg
gtgtcctccttgccaaaaatgatcctgctctccgggctcaccacgtcctacatcctcgtt
ctggagctcagcggatacaccaggactgggggtggtgccgtctccgggcgcagctacgag
ccaattgtggccatcctgctcttctcctgtgcgctggccctgcatgccaggcaggtggac
atcaggctgaggctggactacctctgggccgcacaggcagaggaggagcgagaggacatg
gagaaggtgaagctggacaacaggcgcatcctcttcaacctcctgccggcccacgtcgcc
cagcacttcctcatgtccaaccctcggaacatggacctctactaccagtcctactcccag
gtgggcgtcatgtttgcctccatccccaacttcaatgacttctacatcgagctggacggc
aacaacatgggggtggagtgtctgcggcttctcaacgagatcatcgccgactttgacgag
ctcatggaaaaagacttttacaaggacatagagaagatcaagaccatcgggagcacctac
atggccgctgtggggctagcgcccacctcggggaccaaggctaagaagtccatctcctcc
cacctgagcacgctggcggactttgccattgagatgtttgacgttctggatgaaatcaac
taccagtcttacaacgacttcgtcctccgagttggcatcaatgttggccctgtggtggct
ggagtgattggcgctcgcaggccccagtacgacatctggggaaacacagtcaacgtggcc
agtcggatggatagcacaggggtccagggcagaatccaggtgactgaggaagtccaccgg
ctgctgagaaggtgcccctaccactttgtgtgccgaggcaaagtcagtgtcaagggcaaa
ggcgagatgttgacatactttctagaaggcaggactgatggaaacggctcccaaatcagg
tccctgggcttggatcggaaaatgtgtccatttgggagagctggccttcagggcagacgt
cccccggtgtgccccatgcctggcgtctcagtcagggccgggctccctccacactcccca
ggccagtacctgccctctgcagcagctgggaaggaggcttag

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126268
Entry
101126268         CDS       T02442                                 

Gene name
ADCY7
Definition
(RefSeq) adenylate cyclase type 7 isoform X1
  KO
K08047  adenylate cyclase 7 [EC:4.6.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00230  Purine metabolism
ggo01100  Metabolic pathways
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04727  GABAergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05032  Morphine addiction
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101126268 (ADCY7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101126268 (ADCY7)
   04371 Apelin signaling pathway
    101126268 (ADCY7)
   04020 Calcium signaling pathway
    101126268 (ADCY7)
   04072 Phospholipase D signaling pathway
    101126268 (ADCY7)
   04024 cAMP signaling pathway
    101126268 (ADCY7)
   04022 cGMP-PKG signaling pathway
    101126268 (ADCY7)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101126268 (ADCY7)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101126268 (ADCY7)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101126268 (ADCY7)
   04062 Chemokine signaling pathway
    101126268 (ADCY7)
  09152 Endocrine system
   04911 Insulin secretion
    101126268 (ADCY7)
   04923 Regulation of lipolysis in adipocytes
    101126268 (ADCY7)
   04912 GnRH signaling pathway
    101126268 (ADCY7)
   04913 Ovarian steroidogenesis
    101126268 (ADCY7)
   04915 Estrogen signaling pathway
    101126268 (ADCY7)
   04914 Progesterone-mediated oocyte maturation
    101126268 (ADCY7)
   04921 Oxytocin signaling pathway
    101126268 (ADCY7)
   04926 Relaxin signaling pathway
    101126268 (ADCY7)
   04935 Growth hormone synthesis, secretion and action
    101126268 (ADCY7)
   04918 Thyroid hormone synthesis
    101126268 (ADCY7)
   04928 Parathyroid hormone synthesis, secretion and action
    101126268 (ADCY7)
   04916 Melanogenesis
    101126268 (ADCY7)
   04925 Aldosterone synthesis and secretion
    101126268 (ADCY7)
   04927 Cortisol synthesis and secretion
    101126268 (ADCY7)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101126268 (ADCY7)
   04270 Vascular smooth muscle contraction
    101126268 (ADCY7)
  09154 Digestive system
   04970 Salivary secretion
    101126268 (ADCY7)
   04971 Gastric acid secretion
    101126268 (ADCY7)
   04972 Pancreatic secretion
    101126268 (ADCY7)
   04976 Bile secretion
    101126268 (ADCY7)
  09156 Nervous system
   04724 Glutamatergic synapse
    101126268 (ADCY7)
   04727 GABAergic synapse
    101126268 (ADCY7)
   04725 Cholinergic synapse
    101126268 (ADCY7)
   04723 Retrograde endocannabinoid signaling
    101126268 (ADCY7)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101126268 (ADCY7)
  09149 Aging
   04211 Longevity regulating pathway
    101126268 (ADCY7)
   04213 Longevity regulating pathway - multiple species
    101126268 (ADCY7)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101126268 (ADCY7)
   04714 Thermogenesis
    101126268 (ADCY7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101126268 (ADCY7)
  09165 Substance dependence
   05032 Morphine addiction
    101126268 (ADCY7)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101126268 (ADCY7)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101126268 (ADCY7)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101126268 (ADCY7)
   05163 Human cytomegalovirus infection
    101126268 (ADCY7)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101126268 (ADCY7)
Enzymes [BR:ggo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101126268 (ADCY7)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N
Other DBs
NCBI-GeneID: 101126268
NCBI-ProteinID: XP_004057679
Ensembl: ENSGGOG00000014807
UniProt: G3RFS8
LinkDB
Position
16
AA seq 1080 aa
MPAKGRYFLNEGEEGPDQDALYEKYQLTSQHGPLLLTLLLVAATACVALIIIAFSQGDPS
RHQAILGMAFLALAVFATLSVLMYVECLLRRWLRALALLTWACLVALGYVLVFDAWTKAA
CAWEQVPFFLFIVFVVYTLLPFSMRGAVAVGAVSTASHLLVLGSLMGGFTTPSVQVGLQL
LANAVIFLCGNLTGAFHKHQMQDASRDLFTYTVKCIQIRRKLRIEKRQQENLLLSVLPAH
ISMGMKLAIIERLKEHGDRRCMPDNNFHSLYVKRHQNVSILYADIVGFTQLASDCSPKEL
VVVLNELFGKFDQIAKANECMRIKILGDCYYCVSGLPVSLPTHARNCVKMGLDMCQAIKQ
VREATGVDINMRVGIHSGNVLCGVIGLRKWQYDVWSHDVSLANRMEAAGVPGRVHITEAT
LKHLDKAYEVEDGHGQQRDPYLKEMNIRTYLVIDPRSQQPPPPSQHLPRPKGDAALKMRA
SVRMTRYLESWGAARPFAHLNHRESVSSGETPVPNGRRPKSVPPRHRRTPDRSMSPKGRS
EDDSYDDEMLSAIEGLSSTRPCCSKSDDFYTFGSIFLEKGFEREYRLAPIPRARHDFACA
SLIFVCILLVHVLLMPRTAALGVSFGLVACVLGLVLGLCFATKFSRCCPARGTLCTISER
VETQPLLRLTLAVLTIGSLLTVAIINLPLMPFQVPELPVGNETGLPAASSKTRALCEPLP
YYTCSCVLGFIACSVFLRMSLEPKVVLLTVALVAYLVLFNLSPCWQWDCCGQGLGNLTEP
NGTTSGTPSCSWKDLKTMTNFYLVLFYITLLTLSRQIDYYCRLDCLWKKKFKKEHEEFET
MENVNRLLLENVLPAHVAAHFIGDKLNEDWYHQSYDCVCVMFASVPDFKVFYTECDVNKE
GLECLRLLNEIIADFDELLLKPKFSGVEKIKTIGSTYMAAAGLSVASGHENQELERQHAH
IGVMVEFSIALMSKLDGINRHSFNSFRLRVGINHGPVIAGVIGARKPQYDIWGNTVNVAS
RMESTGELGKIQVTEETCTILQNLGYSCECRGLINVKGKGELRTYFVCTDTAKFQGLGLN
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgccagccaaggggcgctacttcctcaacgagggcgaggagggccctgaccaagatgcg
ctctacgagaagtaccagctcaccagccagcatgggccgctgctgctcacgctcctgctg
gtggccgccactgcctgcgtggccctcatcatcatcgccttcagccagggggacccctcc
agacaccaggccattctgggcatggcgttcctggcgctggcggtgtttgcgaccctctct
gtgctgatgtacgtcgagtgtctcctgcggcgctggctcagggccttggcgctgctcacc
tgggcctgcttggtggcgctgggctatgtgctggtgttcgacgcatggacaaaggcggcc
tgtgcgtgggagcaggtgcccttcttcctgttcatcgtcttcgtggtgtacacgctactg
cccttcagcatgcggggcgctgtcgccgttggggccgtctccactgcctcccacctcctg
gtgctcggttctttgatgggaggcttcacgacacccagtgtccaggtggggctgcagctg
ctggccaacgcagtcatcttcctgtgcgggaacctgacaggcgccttccacaagcaccaa
atgcaggatgcatcccgggacctcttcacctacactgtgaagtgcatccagatccgtcgg
aagctgcgcatcgagaagcgccagcaggagaacctgctgctgtcagtgcttccggcccac
atctccatgggcatgaagctggccatcatcgaacggctcaaggagcatggtgaccgtcgc
tgcatgcccgacaacaacttccacagcctctacgtcaagaggcaccagaatgtcagcatc
ctctatgcggacatcgtgggcttcacgcagctggccagcgactgttcccccaaggagttg
gtggtggtgctgaatgagctctttggcaagttcgaccagatcgccaaggccaacgagtgc
atgcgaatcaagatcctcggcgactgctactactgtgtatcgggcctgcccgtgtcgctg
cctacccacgcccggaactgcgtgaagatggggctggacatgtgccaggccatcaagcag
gtgcgggaggccacgggcgtggacatcaacatgcgtgtgggcatacactcggggaatgtg
ctgtgcggggtcatcgggctgcgcaagtggcagtatgacgtgtggtcccacgacgtgtcc
ctggccaaccggatggaggcagccggagtacccggccgggtgcacatcacggaggcgacg
ctaaagcacctggacaaggcgtacgaggtggaggatgggcacgggcagcagcgggacccc
tacctcaaggagatgaacatccgcacctacctggtcatcgacccccggagccagcagcca
cccccgcccagccaacacctccccaggcccaagggggacgcggccctgaagatgcgggcg
tcagtgcgcatgacccggtacctcgagtcctggggggcggcacggccctttgcgcatctc
aaccaccgtgagagcgtgagcagtggtgagacccccgtccccaacgggcggaggcctaag
agcgttcctccgcgccaccgccggaccccagacagaagcatgtcccccaaggggcggtcg
gaggatgactcgtacgatgatgagatgctgtcagccattgaggggctcagctccacgagg
ccctgctgctccaagtctgacgacttctacacctttgggtccatcttcctggagaagggc
tttgagcgtgagtaccgcctggcacccatcccccgggcccgccacgactttgcctgtgcc
agcctgatcttcgtctgcatcctgctcgtccatgtcctgctcatgcccaggacggcggca
ctgggtgtgtccttcgggctggtggcctgtgtactggggctggtgctgggcctgtgcttt
gccaccaagttctcgaggtgctgcccagctcgggggacgctctgcactatctctgagagg
gtggagacacagcccctgctgaggctgaccctggccgtcctgaccatcggcagcctgctc
actgtggccatcatcaacctgcccctgatgcctttccaagttccagagctgcctgttggc
aatgagacaggcctacctgccgcgagcagcaagacaagagccctgtgcgagcccctcccg
tactacacctgcagctgtgtcctgggcttcatcgcctgctcggtcttcctgaggatgagc
ctggagccaaaggttgtgctgctgacagtggccctggtggcctacctggtgctcttcaac
ctctccccatgctggcagtgggactgctgtggccaaggcctgggcaacctcactgagccc
aacggcaccaccagtggcacccctagctgttcctggaaggacctgaagaccatgaccaat
ttctacctggtcctgttttacatcaccctgctcacactctccagacagattgactattac
tgccgcttggactgcctatggaagaaaaagttcaagaaggagcacgaggagtttgagacc
atggagaatgtgaaccgccttcttctggagaacgtcctgccagcccacgtggctgcccac
tttatcggtgacaagttaaacgaggactggtaccatcagtcctatgactgcgtctgtgtc
atgtttgcctccgtgccggacttcaaagtgttctacacagagtgcgatgtcaacaaagaa
gggctggagtgcctacgcctgctcaatgagatcattgccgacttcgacgagctcctactg
aagcccaagttcagcggcgtggagaagatcaagaccatcggcagcacgtacatggcagct
gcagggctcagcgtcgcctcagggcacgagaaccaggagctggagcggcagcatgcccac
attggtgtcatggtggagttcagcatcgccctgatgagtaagctggacggcatcaacagg
cactccttcaactccttccgcctccgcgtcggcataaatcatgggcctgtgattgctgga
gtgattggggcccgaaaacctcagtatgacatctggggaaacacagtcaacgtggccagc
cgaatggagagcactggagaacttgggaaaatccaggttaccgaggagacctgcaccatc
ctccagaacctcgggtactcttgtgaatgccgtggcctgatcaacgtcaaaggcaaaggc
gagctgaggacttactttgtctgtacggacactgccaagtttcaggggctggggctgaac
tga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101139873
Entry
101139873         CDS       T02442                                 

Gene name
ADCY6
Definition
(RefSeq) adenylate cyclase type 6
  KO
K08046  adenylate cyclase 6 [EC:4.6.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00230  Purine metabolism
ggo01100  Metabolic pathways
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04727  GABAergic synapse
ggo04742  Taste transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04962  Vasopressin-regulated water reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05032  Morphine addiction
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101139873 (ADCY6)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101139873 (ADCY6)
   04371 Apelin signaling pathway
    101139873 (ADCY6)
   04072 Phospholipase D signaling pathway
    101139873 (ADCY6)
   04024 cAMP signaling pathway
    101139873 (ADCY6)
   04022 cGMP-PKG signaling pathway
    101139873 (ADCY6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101139873 (ADCY6)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101139873 (ADCY6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101139873 (ADCY6)
   04062 Chemokine signaling pathway
    101139873 (ADCY6)
  09152 Endocrine system
   04911 Insulin secretion
    101139873 (ADCY6)
   04923 Regulation of lipolysis in adipocytes
    101139873 (ADCY6)
   04912 GnRH signaling pathway
    101139873 (ADCY6)
   04913 Ovarian steroidogenesis
    101139873 (ADCY6)
   04915 Estrogen signaling pathway
    101139873 (ADCY6)
   04914 Progesterone-mediated oocyte maturation
    101139873 (ADCY6)
   04921 Oxytocin signaling pathway
    101139873 (ADCY6)
   04926 Relaxin signaling pathway
    101139873 (ADCY6)
   04935 Growth hormone synthesis, secretion and action
    101139873 (ADCY6)
   04918 Thyroid hormone synthesis
    101139873 (ADCY6)
   04928 Parathyroid hormone synthesis, secretion and action
    101139873 (ADCY6)
   04916 Melanogenesis
    101139873 (ADCY6)
   04924 Renin secretion
    101139873 (ADCY6)
   04925 Aldosterone synthesis and secretion
    101139873 (ADCY6)
   04927 Cortisol synthesis and secretion
    101139873 (ADCY6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101139873 (ADCY6)
   04270 Vascular smooth muscle contraction
    101139873 (ADCY6)
  09154 Digestive system
   04970 Salivary secretion
    101139873 (ADCY6)
   04971 Gastric acid secretion
    101139873 (ADCY6)
   04972 Pancreatic secretion
    101139873 (ADCY6)
   04976 Bile secretion
    101139873 (ADCY6)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101139873 (ADCY6)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101139873 (ADCY6)
  09156 Nervous system
   04724 Glutamatergic synapse
    101139873 (ADCY6)
   04727 GABAergic synapse
    101139873 (ADCY6)
   04725 Cholinergic synapse
    101139873 (ADCY6)
   04723 Retrograde endocannabinoid signaling
    101139873 (ADCY6)
  09157 Sensory system
   04742 Taste transduction
    101139873 (ADCY6)
   04750 Inflammatory mediator regulation of TRP channels
    101139873 (ADCY6)
  09149 Aging
   04211 Longevity regulating pathway
    101139873 (ADCY6)
   04213 Longevity regulating pathway - multiple species
    101139873 (ADCY6)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101139873 (ADCY6)
   04714 Thermogenesis
    101139873 (ADCY6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101139873 (ADCY6)
  09165 Substance dependence
   05032 Morphine addiction
    101139873 (ADCY6)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101139873 (ADCY6)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101139873 (ADCY6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101139873 (ADCY6)
   05163 Human cytomegalovirus infection
    101139873 (ADCY6)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101139873 (ADCY6)
Enzymes [BR:ggo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101139873 (ADCY6)
SSDB
Motif
Pfam: AC_N Guanylate_cyc DUF1053 HNOBA TBK1_ULD Shisa
Other DBs
NCBI-GeneID: 101139873
NCBI-ProteinID: XP_004053103
Ensembl: ENSGGOG00000002316
UniProt: G3QIR6
LinkDB
Position
12
AA seq 1168 aa
MSWFSGLLVPKVDERKTAWGERNGQKRSRRRGTRAGGFCTPRYMSCLRDAEPPSPTSAGP
PRCPWQDDAFIRRGGPGKGKELGLRAVALGFEDTEVTTTAGGTAEVAPDAVPRSGRSCWR
RLVQVFQSKQFRSAKLERLYQRYFFQMNQSSLTLLMAVLVLLTAVLLAFHAAPARPQPAY
VALLACAAALFVGLMVVCNRHSFRQDSMWVVSYVVLGILAAVQVGGALAADPRSPSAGLW
CPVFFVYIAYTLLPIRMRAAVLSGLGLSTLHLILAWQLNRGDAFLWKQLGANVLLFLCTN
VIGICTHYPAEVSQRQAFQETRGYIQARLHLQHENRQQERLLLSVLPQHVAMEMKEDINT
KKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHC
LRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRV
HCGVLGLRKWQFDVWSNDVTLANHMEAGGRAGRIHITRATLQYLNGDYEVEPGRGGERNA
YLKEQHIETFLILGASQKRKEEKAMLAKLQRTRANSMEGLMPRWVPDRAFSRTKDSKAFR
QMGIDDSSKDNRGTQDALNPEDEVDEFLSRAIDARSIDQLRKDHVRRFLLTFQREDLEKK
YSRKVDPRFGAYVACALLVFCFICFIQLLIFPHSTLMLGIYASIFLLLLITVLICAVYSC
GSLFPKALQRLSRSIVRSRAHSTAVGIFSVLLVFTSAIANMFTCNHTPIRTCAARMLNLT
PADITACHLQQLNYSLGLDAPLCEGTMPTCSFPEYFIGNMLLSLLASSVFLHISSIGKLA
MIFVLGLIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKYMTPV
ILLVFALALYLHAQQVESTARLDFLWKLQATGEKEEMEELQAYNRRLLHNILPKDVAAHF
LARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLNEIIADFDEIIS
EERFRQLEKIKTIGSTYMAASGLNASTYDQVGRSHITALADYAMRLMEQMKHINEHSFNN
FQMKIGLNMGPVVAGVIGARKPQYDIWGNTVNVSSRMDSTGVPDRIQVTTDLYQVLAAKG
YQLECRGVVKVKGKGEMTTYFLNGGPSS
NT seq 3507 nt   +upstreamnt  +downstreamnt
atgtcatggtttagtggcctcctggtccctaaagtggatgaacggaaaacagcctggggt
gaacgcaatgggcagaagcgttcgcggcgccgtggcactcgggcaggtggcttctgcacg
ccccgctatatgagctgcctccgggatgcagagccacccagccccacctctgcgggcccc
cctcggtgtccctggcaggatgacgccttcatccggaggggcggcccaggcaagggcaag
gagctggggctgcgggcagtggccctgggcttcgaggataccgaggtgacaacgacagcg
ggcgggacggctgaggtggcgcccgacgcggtgcccaggagtgggcgatcctgctggcgc
cgtctggtgcaggtgttccagtcgaagcagttccgttcggccaagctggagcgcctgtac
cagcggtacttcttccagatgaaccagagcagcctgacgctgctgatggcggtgctggtg
ctgctcacggcggtgctgctggctttccacgccgcacctgcccgccctcagcctgcctat
gtggcactgttggcctgtgccgccgccctgttcgtggggctcatggtggtgtgtaaccgg
catagcttccgccaggactccatgtgggtggtgagctacgtggtgctgggcatcctggcg
gcagtgcaggtcgggggcgccctcgcagcagacccgcgcagcccctctgcgggcctctgg
tgccctgtgttctttgtctacatcgcctacacgctcctccccatccgcatgcgggctgcc
gtcctcagcggcctgggcctctccaccttgcatttgatcttggcctggcaacttaaccgt
ggtgatgccttcctctggaagcagctcggtgccaatgtgctgctgttcctctgcaccaat
gtcattggcatctgcacacactatccagcagaggtgtctcagcgccaggcctttcaggag
acccgcggttacatccaggcccggctccacctgcagcatgagaatcggcagcaggagcgg
ctgctgctgtcggtattgccccagcacgttgccatggagatgaaagaagacatcaacaca
aaaaaagaagacatgatgttccacaagatctacatacagaagcatgacaatgtcagcatc
ctgtttgcagacattgagggcttcaccagcctggcatcccagtgcaccgcccaggagctg
gtcatgaccctgaatgagctctttgcccggtttgacaagctggctgcggagaatcactgc
ctgaggatcaagatcttgggggactgttactactgtgtgtcagggctgccagaggccagg
gccgaccatgcccactgctgtgtggagatgggggtagacatgatcgaggccatctcgctg
gtacgtgaggtgacaggtgtgaatgtgaacatgcgcgtgggcatccacagcgggcgagtg
cactgcggcgtccttggcttgcggaaatggcagttcgatgtgtggtccaatgatgtgacc
ctggccaaccacatggaggcaggaggccgggctggccgcatccacatcactcgggcaaca
ctgcagtacctgaatggggactacgaggtggagccaggccgtggtggcgagcgcaacgca
tacctcaaggagcagcacattgagactttcctcatcctgggcgccagccagaaacggaaa
gaggagaaggccatgctggccaagctgcagcggactcgggccaactccatggaagggctg
atgccgcgctgggtgcctgatcgtgccttctcccggaccaaggactccaaggccttccgc
cagatgggcattgatgattccagcaaagacaaccggggcacccaagatgccctgaaccct
gaggatgaggtggatgagttcctgagccgtgccattgatgcccgcagcattgatcagctg
cggaaggaccatgtgcgccggtttctgctcaccttccagagagaggatcttgagaagaag
tactcccggaaggtggatccccgcttcggagcctacgttgcctgtgccctgttggtcttc
tgcttcatctgcttcatccagcttctcatcttcccacactccaccctgatgcttgggatc
tatgccagcatcttcctgctgctgctgatcaccgtgctgatctgtgccgtgtactcctgt
ggttctctgttccctaaggccctgcaacgtctgtcccgcagcattgtccgctcacgggca
catagcaccgcagttggcatcttttccgtcctgcttgtgtttacttctgccattgccaac
atgttcacctgtaaccacacccccatacggacctgtgcagcccggatgctgaatttaaca
cctgctgacatcactgcctgccacctgcagcagctcaattactctctgggcctggatgct
cccctgtgtgagggcaccatgcccacctgcagctttcctgagtacttcatcgggaacatg
ctgctgagtctcttggccagctctgtcttcctgcacatcagcagcatcgggaagttggcc
atgatctttgtcttggggctcatctatttggtgctgcttctgctgggtcccccagccacc
atctttgacaactatgacctactgcttggcgtccatggcttggcttcttccaatgagacc
tttgatgggctggactgtccagctgcagggagggtggccctcaaatatatgacccctgtg
attctgctggtgtttgcgctggcgctgtatctgcatgctcagcaggtggagtcgactgcc
cgcctcgacttcctctggaaactacaggcaacaggggagaaggaggagatggaggagcta
caggcatacaaccggaggctgctgcataacattctgcccaaggacgtggcggcccacttc
ctggcccgggagcgccgcaatgatgaactctactatcagtcgtgtgagtgcgtggctgtt
atgtttgcctccattgccaacttctctgagttctatgtggagctggaggcaaacaatgag
ggtgtcgagtgcctgcggctgctcaacgagatcatcgctgactttgatgagattatcagc
gaggagcggttccggcagctggaaaagatcaagacgattggtagcacctacatggctgcc
tcagggctgaacgccagcacctacgatcaggtgggccgctctcacatcactgccctggct
gactacgccatgcggctcatggagcagatgaagcacatcaatgagcactccttcaacaat
ttccagatgaagattgggctgaacatgggcccagtcgtggcaggtgtcatcggggctcgg
aagccacagtatgacatctgggggaacacagtgaatgtctctagtcgtatggacagcacg
ggggtccccgaccgaatccaggtgaccacggacctgtaccaggttctagctgccaagggc
taccagctggagtgtcgaggggtggtcaaggtgaagggcaagggggagatgaccacctac
ttcctcaatgggggccccagcagttaa

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101141389
Entry
101141389         CDS       T02442                                 

Gene name
ADCY2
Definition
(RefSeq) adenylate cyclase type 2
  KO
K08042  adenylate cyclase 2 [EC:4.6.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00230  Purine metabolism
ggo01100  Metabolic pathways
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04727  GABAergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05032  Morphine addiction
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101141389 (ADCY2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101141389 (ADCY2)
   04371 Apelin signaling pathway
    101141389 (ADCY2)
   04020 Calcium signaling pathway
    101141389 (ADCY2)
   04072 Phospholipase D signaling pathway
    101141389 (ADCY2)
   04024 cAMP signaling pathway
    101141389 (ADCY2)
   04022 cGMP-PKG signaling pathway
    101141389 (ADCY2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101141389 (ADCY2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101141389 (ADCY2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101141389 (ADCY2)
   04062 Chemokine signaling pathway
    101141389 (ADCY2)
  09152 Endocrine system
   04911 Insulin secretion
    101141389 (ADCY2)
   04922 Glucagon signaling pathway
    101141389 (ADCY2)
   04923 Regulation of lipolysis in adipocytes
    101141389 (ADCY2)
   04912 GnRH signaling pathway
    101141389 (ADCY2)
   04913 Ovarian steroidogenesis
    101141389 (ADCY2)
   04915 Estrogen signaling pathway
    101141389 (ADCY2)
   04914 Progesterone-mediated oocyte maturation
    101141389 (ADCY2)
   04921 Oxytocin signaling pathway
    101141389 (ADCY2)
   04926 Relaxin signaling pathway
    101141389 (ADCY2)
   04935 Growth hormone synthesis, secretion and action
    101141389 (ADCY2)
   04918 Thyroid hormone synthesis
    101141389 (ADCY2)
   04928 Parathyroid hormone synthesis, secretion and action
    101141389 (ADCY2)
   04916 Melanogenesis
    101141389 (ADCY2)
   04925 Aldosterone synthesis and secretion
    101141389 (ADCY2)
   04927 Cortisol synthesis and secretion
    101141389 (ADCY2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101141389 (ADCY2)
   04270 Vascular smooth muscle contraction
    101141389 (ADCY2)
  09154 Digestive system
   04970 Salivary secretion
    101141389 (ADCY2)
   04971 Gastric acid secretion
    101141389 (ADCY2)
   04972 Pancreatic secretion
    101141389 (ADCY2)
   04976 Bile secretion
    101141389 (ADCY2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101141389 (ADCY2)
   04727 GABAergic synapse
    101141389 (ADCY2)
   04725 Cholinergic synapse
    101141389 (ADCY2)
   04723 Retrograde endocannabinoid signaling
    101141389 (ADCY2)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101141389 (ADCY2)
  09149 Aging
   04211 Longevity regulating pathway
    101141389 (ADCY2)
   04213 Longevity regulating pathway - multiple species
    101141389 (ADCY2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101141389 (ADCY2)
   04714 Thermogenesis
    101141389 (ADCY2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101141389 (ADCY2)
  09165 Substance dependence
   05032 Morphine addiction
    101141389 (ADCY2)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101141389 (ADCY2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101141389 (ADCY2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101141389 (ADCY2)
   05163 Human cytomegalovirus infection
    101141389 (ADCY2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101141389 (ADCY2)
Enzymes [BR:ggo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101141389 (ADCY2)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N HNOBA
Other DBs
NCBI-GeneID: 101141389
NCBI-ProteinID: XP_030859316
Ensembl: ENSGGOG00000011188
LinkDB
Position
17
AA seq 1091 aa
MWQEAMRRRRYLRDRAEEAAGGGDGLPRSRDWLYESYYCMSQQHPLIVFLLLIVMGSCLA
LLAVFFALGLEVEDHVAFLITVPTALAIFFAIFILVCIESVFKKLLRLFSLVIWICLVAM
GYLFMCFGGTVSPWDQVSFFLFIIFVVYTMLPFNMRDAIIASVLTSSSHTIVLSVCLSAT
PGGKEHLVWQILANVIIFICGNLAGAYHKHLMELALQQTYQDTCNCIKSRIKLEFEKRQQ
ERLLLSLLPAHIAMEMKAEIIQRLQGPKAGQMENTNNFHNLYVKRHTNVSILYADIVGFT
RLASDCSPGELVHMLNELFGKFDQIAKENECMRIKILGDCYYCVSGLPISLPNHAKNCVK
MGLDMCEAIKKVRDATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGG
VPGRVHISSVTLEHLNGAYKVEEGDGDIRDPYLKQHLVKTYFVINPKGERRSPQHLFRPR
HTLDGAKMRASVRMTRYLESWGAAKPFAHLHHRDSMTTENGKISTTDVPMGQHNFQNRTL
RTKSQKKRFEEELNERMIQAIDGINAQKQWLKSEDIQRISLLFYNKVLEKEYRATALPAF
KYYVTCACLIFFCIFIVQILVLPKTSVLGISFGAAFLLLAFILFVCFAGQLLQCSKKASP
LLMWLLKSSGIIANRPWPRISLTIITTAIILMMAVFNMFFLSDSEETIPPTANTTNTSFS
ASNNQVAILRAQNLFFLPYFIYSCILGLISCSVFLRVNYELKMLIMMVALVGYNTILLHT
HARVLGDYSQVLFERPGIWKDLKTMGSVSLSIFFITLLVLGRQNEYYCRLDFLWKNKFKK
EREEIETMENLNRVLLENVLPAHVAEHFLARSLKNEELYHQSYDCVCVMFASIPDFKEFY
TESDVNKEGLECLRLLNEIIADFDDLLSKPKFSGVEKIKTIGSTYMAATGLSAVPSQEHS
QEPERQYMHIGTMVEFAFALVGKLDAINKHSFNDFKLRVGINHGPVIAGVIGAQKPQYDI
WGNTVNVASRMDSTGVLDKIQVTEETSLVLQTLGYTCTCRGIINVKGKGDLKTYFVNTEM
SRSLSQSNVAS
NT seq 3276 nt   +upstreamnt  +downstreamnt
atgtggcaggaggcgatgcggcgccgccgctacctgcgggaccgcgccgaggaggcggcg
ggcggcggagacgggctgccgcggtcccgggactggctctacgagtcctactactgcatg
agccagcagcacccgctcatcgtcttcctgctgctcatcgtcatgggctcctgcctcgcc
ctgctcgccgtcttcttcgcgctcgggctggaagttgaagaccatgtggcgtttctaata
acagttccaactgccctggcgattttctttgcgatatttatcctggtctgcatcgagtct
gtgtttaagaagctgctgcgcctcttctcgttggtgatatggatatgccttgttgccatg
ggatacctgttcatgtgttttggaggcaccgtctctccctgggaccaggtatcattcttc
ctcttcatcatcttcgtggtgtacaccatgctgcccttcaacatgcgagacgccatcatt
gccagcgtcctcacctcctcctcccacaccatcgtgcttagcgtctgcctgtctgcaaca
ccgggaggcaaggagcacctggtctggcagatcctggccaatgtgatcattttcatctgt
gggaacctggcgggagcctaccataagcacctcatggaactcgctcttcagcaaacatat
caggacacctgtaattgcatcaagtcccggatcaagttggaatttgaaaaacgtcaacag
gagcggcttctgctctccctgctgccggcccacatcgccatggagatgaaagcggagatc
atccagaggctgcagggccccaaggcgggccagatggagaacacaaataacttccacaac
ctgtatgtgaagcggcataccaacgtgagcatcttatacgccgacatcgttggctttacc
cggctggcaagtgactgctccccgggagaactagtccacatgctgaatgagctctttgga
aagtttgatcaaattgcaaaggagaatgaatgcatgagaattaaaattttaggagactgc
tactactgtgtatctggactccctatatctctccctaaccatgccaagaactgtgtgaaa
atggggctggacatgtgtgaagccataaagaaagtgagggatgctactggagttgatatc
aacatgcgcgtgggcgtgcattctgggaatgtcctgtgcggcgtgattggtctgcagaag
tggcaatatgatgtgtggtcacatgatgtgaccttggccaaccacatggaagctggaggg
gtccctggacgtgttcacatttcttctgtcaccctggagcacttgaatggcgcttataaa
gtggaggagggagatggtgacattagggacccatatttaaaacagcacctggtgaaaacc
tactttgtgatcaaccccaagggagaacgacggagcccccagcatctcttcagacctcgc
cacacccttgatggagccaaaatgagggcctcggtccgcatgacccggtacttggagtcc
tggggggcagccaagccctttgcacacctacatcacagggacagcatgaccacagagaac
ggcaagatcagcaccacggatgtacccatgggtcagcataattttcaaaatcgcacctta
agaaccaagtcacaaaagaagagatttgaagaagaattgaatgaaaggatgattcaagca
attgatgggattaatgcacagaagcaatggctcaagtctgaagacattcagagaatctca
ctgcttttctataacaaagtactagaaaaagagtaccgggccacggcactgccagcgttc
aagtattatgtgacttgtgcctgtctcatattcttctgcatcttcattgtgcagattctt
gtgctgccaaaaacgtccgtcctgggcatctcctttggggctgcgtttctcttgctggcc
ttcatcctcttcgtctgctttgctggacagcttctgcaatgcagcaaaaaagcctctccc
ctgctcatgtggcttttgaagtcctcgggcatcattgccaaccgcccctggccacggatc
tctctcacgatcatcaccacagccatcatattaatgatggccgtgttcaacatgtttttc
ctgagtgactcagaggaaacaatccctccaactgccaacacaacaaacacaagcttttca
gcctcaaataatcaggtggcgattctgcgtgcgcaaaatttatttttcctcccgtacttt
atctacagctgcattctgggactgatatcctgttccgtgttcctgcgggtaaactatgag
ctgaagatgttgatcatgatggtggccttggtgggctacaacaccatcctactccacacc
cacgcccgcgtcctgggcgactacagccaggtcttatttgagagaccaggcatttggaaa
gacctgaagaccatgggctctgtgtctctctctatattcttcatcacactgcttgttctg
ggtagacagaatgaatattactgtaggttagacttcttatggaagaacaaattcaaaaaa
gagcgggaggagatagagaccatggagaacctgaaccgcgtgctgctggagaacgtgctt
cccgcgcacgtggctgagcacttcctggccaggagcctgaagaatgaggagctataccac
cagtcctatgactgcgtctgcgtcatgtttgcctccattccggatttcaaagaattttat
acagaatccgacgtgaacaaggagggcttggaatgccttcggctcctgaacgagatcatc
gctgactttgatgatcttctttccaagccaaaattcagtggagttgaaaagattaagacc
attggcagcacatacatggcagcaacaggtctgagcgctgtacccagccaggagcactcc
caggagcccgagcggcagtacatgcacattggcaccatggtggagtttgcttttgccctg
gtagggaagctggatgccatcaacaagcactccttcaacgacttcaaattgcgagtgggt
attaaccatggacctgtgatagctggtgtgattggagctcagaagccacaatatgatatc
tggggcaacactgtcaatgtggccagtaggatggacagcaccggagtcctggacaaaata
caggttaccgaggagacgagcctcgtcctgcagaccctcggatacacgtgcacctgtcga
ggaataatcaacgtgaaaggaaagggggacctgaagacgtactttgtaaacacagaaatg
tcaaggtccctttcccagagcaacgtggcatcctga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101142672
Entry
101142672         CDS       T02442                                 

Gene name
ADCY8
Definition
(RefSeq) adenylate cyclase type 8 isoform X1
  KO
K08048  adenylate cyclase 8 [EC:4.6.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00230  Purine metabolism
ggo01100  Metabolic pathways
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04727  GABAergic synapse
ggo04742  Taste transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05032  Morphine addiction
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101142672 (ADCY8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101142672 (ADCY8)
   04371 Apelin signaling pathway
    101142672 (ADCY8)
   04020 Calcium signaling pathway
    101142672 (ADCY8)
   04072 Phospholipase D signaling pathway
    101142672 (ADCY8)
   04024 cAMP signaling pathway
    101142672 (ADCY8)
   04022 cGMP-PKG signaling pathway
    101142672 (ADCY8)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101142672 (ADCY8)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101142672 (ADCY8)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101142672 (ADCY8)
   04062 Chemokine signaling pathway
    101142672 (ADCY8)
  09152 Endocrine system
   04911 Insulin secretion
    101142672 (ADCY8)
   04923 Regulation of lipolysis in adipocytes
    101142672 (ADCY8)
   04912 GnRH signaling pathway
    101142672 (ADCY8)
   04913 Ovarian steroidogenesis
    101142672 (ADCY8)
   04915 Estrogen signaling pathway
    101142672 (ADCY8)
   04914 Progesterone-mediated oocyte maturation
    101142672 (ADCY8)
   04921 Oxytocin signaling pathway
    101142672 (ADCY8)
   04926 Relaxin signaling pathway
    101142672 (ADCY8)
   04935 Growth hormone synthesis, secretion and action
    101142672 (ADCY8)
   04918 Thyroid hormone synthesis
    101142672 (ADCY8)
   04928 Parathyroid hormone synthesis, secretion and action
    101142672 (ADCY8)
   04916 Melanogenesis
    101142672 (ADCY8)
   04925 Aldosterone synthesis and secretion
    101142672 (ADCY8)
   04927 Cortisol synthesis and secretion
    101142672 (ADCY8)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101142672 (ADCY8)
   04270 Vascular smooth muscle contraction
    101142672 (ADCY8)
  09154 Digestive system
   04970 Salivary secretion
    101142672 (ADCY8)
   04971 Gastric acid secretion
    101142672 (ADCY8)
   04972 Pancreatic secretion
    101142672 (ADCY8)
   04976 Bile secretion
    101142672 (ADCY8)
  09156 Nervous system
   04724 Glutamatergic synapse
    101142672 (ADCY8)
   04727 GABAergic synapse
    101142672 (ADCY8)
   04725 Cholinergic synapse
    101142672 (ADCY8)
   04720 Long-term potentiation
    101142672 (ADCY8)
   04723 Retrograde endocannabinoid signaling
    101142672 (ADCY8)
  09157 Sensory system
   04742 Taste transduction
    101142672 (ADCY8)
   04750 Inflammatory mediator regulation of TRP channels
    101142672 (ADCY8)
  09149 Aging
   04211 Longevity regulating pathway
    101142672 (ADCY8)
   04213 Longevity regulating pathway - multiple species
    101142672 (ADCY8)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101142672 (ADCY8)
   04714 Thermogenesis
    101142672 (ADCY8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101142672 (ADCY8)
  09165 Substance dependence
   05032 Morphine addiction
    101142672 (ADCY8)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101142672 (ADCY8)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101142672 (ADCY8)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101142672 (ADCY8)
   05163 Human cytomegalovirus infection
    101142672 (ADCY8)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101142672 (ADCY8)
Enzymes [BR:ggo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101142672 (ADCY8)
SSDB
Motif
Pfam: Guanylate_cyc AC_N DUF1053 TBK1_ULD
Other DBs
NCBI-GeneID: 101142672
NCBI-ProteinID: XP_004047581
Ensembl: ENSGGOG00000015786
UniProt: A0A2I2ZTJ4
LinkDB
Position
8
AA seq 1251 aa
MELSDVRCLTGSEELYTIHPTPPAGDGRSASRPQRLLWQTAVRHITEQRFIHGHRGGSGS
GSGGSGKASDPAGGGPNHHAPQLSGDSALPLYSLGPGERAHSTCGTKVFPERSGSGSASG
SGGGGDLGFLHLDCAPSNSDFFLNGGYSYRGVIFPTLRNSFKSRDLERLYQRYFLGQRRK
SEVVMNVLDVLTKLTLLVLHLSLASAPMDPLKGILLGFFTGIEVVICALVVVRKDTTSHT
YLQYSGVVTWVAMTTQILAAGLGYGLLGDGIGYVLFTLFATYSMLPLPLTWAILAGLGTS
LLQVILQVVIPRLAVISINQVVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEAR
LRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADV
KGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAH
CCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKL
ESGGIPGRIHISKATLDCLNGDYNVEEGHGKERNEFLRKHNIETYLIKQPEDSLLSLPED
IVKESVSSSDRRNSGATFTEGSWSPELPFDNIVGKQNTLAALTRNSINLLPNHLAQALHV
QSGPEEINKRIEHTIDLRSGDKLRREHIKPFSLMFKDSSLEHKYSQMRDEVFKSNLVCAF
IVLLFITAIQSLLPSSRVMPMTIQFSILIMLHSALVLITTAEDYKCLPLILRKTCCWINE
TYLARNVIIFASILINFLGAILNILWCDFDKSIPLKNLTFNSSAVFTDICSYPEYFVFTG
VLAMVTCAVFLRLNSVLKLAVLLIMIAIYALLTETVYAGLFLRYDNLNHSGEDFLGTKEA
SLLLMAMFLLAVFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVA
RHFLEKDRDNEELYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDE
LLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKH
SFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLIL
KDQGFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSLAAVVLGLV
QSLNRQRQKQLLNENNNTGIIKGHYNRRTLLSPSGTEPGAQAEGTDKSDLP
NT seq 3756 nt   +upstreamnt  +downstreamnt
atggagctctccgatgtgcgctgccttacaggcagcgaggaactctacaccatccacccg
acgcccccggccggcgacggcaggagcgcctcccggccgcagcggctgctgtggcagacg
gcggtgcgacacatcacggagcagcgcttcattcacgggcaccggggaggcagcggcagc
gggagtggaggctcgggcaaagcctcggaccctgcgggcggcggccccaaccaccacgcg
ccgcagctgtcaggcgactcggcgctgcccctctactcgctgggcccgggagagcgagcg
cacagcacctgcggcaccaaagtcttcccggaacgcagcgggagcggcagtgccagcggc
agcggaggcgggggcgacctgggcttcctgcaccttgactgtgcccctagcaactcggat
ttctttcttaatgggggctatagctaccgaggggtcattttccccaccctgcgcaactcc
ttcaaatctcgggatttggaacgcctctaccagcgctatttcttgggccaaaggcgcaaa
tcggaagtggtgatgaacgtgctggacgtgctgaccaaactcactctcttggtcctacac
ttgagcctggcctcggcccccatggacccgctcaagggcatcctgctgggcttcttcacc
ggcattgaggtagtgatctgcgccctggtggtggtcaggaaggacaccacctcccacacg
tacctgcagtacagcggcgtggtcacctgggtggccatgaccacccagatcctggcagca
ggcctcggctacgggctcctgggcgacggtataggctacgtgctcttcacgctcttcgcc
acctacagtatgctgccgctgccgctcacctgggccatcctggccggcctgggcacctcg
ctgctgcaggtcatcctccaagtggtcataccccggctggcggtcatttccatcaaccag
gttgtggcccaggcagtgttattcatgtgtatgaacacagctggaatcttcatcagttac
ctgtcagaccgggcccagcgacaagctttcctggagactcggaggtgtgtggaggccagg
ctgcgcctggagacagagaaccaaagacaggagcggctcgtgctttctgtgctcccccgg
tttgttgtcctggaaatgatcaacgacatgaccaatgtggaagatgagcacctgcagcac
cagttccatcggatctacatccatcgctatgagaacgtcagtattctttttgcagatgtt
aaaggatttaccaacctctccacgaccttgtctgctcaggagctggtcaggatgctcaac
gagctctttgccagatttgatcgactggcccatgagcatcactgccttcgtattaaaatc
ctgggggactgctactactgcgtgtctggacttcctgagccccgccaggaccatgcccac
tgctgtgttgaaatgggtctcagcatgatcaaaaccatcaggtatgtgcggtcaaggaca
aaacacgatgttgacatgaggattggaatccactcaggctcggtgctgtgcggtgttttg
ggactaaggaagtggcagtttgatgtctggtcttgggatgtggatattgcaaacaaactc
gaatctggaggaatccccgggaggattcacatttccaaagccacgctggactgtctcaac
ggtgactataacgtggaagagggtcatggtaaagagaggaatgaattcctgaggaagcat
aatatcgagacttacttaattaagcagcctgaggacagtctgctgtccttgcctgaagat
atcgtcaaggagtcagtgagctcctcggaccggagaaacagtggggccacattcactgaa
ggatcctggagccctgaactgccctttgataatatcgtggggaaacagaatactctggct
gccctaacaagaaattcaataaatctgcttccaaaccatcttgcacaagctttgcatgtc
cagtctgggcctgaggaaattaacaagagaatagaacataccatcgacttgcggagtggc
gataaattgagaagagagcatatcaagccattctcactgatgtttaaagactccagcctg
gagcacaagtattctcaaatgagggatgaagtgttcaagtcaaacttggtctgtgcattt
atcgttcttctatttatcacggcaatacaaagtttgcttccttcttcaagagtgatgcca
atgaccatccagttctccattctgattatgctgcactcggctctggtcctcatcaccaca
gcagaggattataaatgtttgcccctcatcctccggaaaacttgctgttggattaatgag
acctatttggcccggaacgtcatcatctttgcatccattttgatcaatttcctgggtgcc
atcttaaatatcctgtggtgtgattttgacaagtcgatacccttgaagaacctgactttc
aattcctcagctgtgtttacagatatctgctcctacccagagtactttgtcttcacgggg
gtgttggccatggtgacctgtgcagttttcctccggctgaactccgtcctgaagctggca
gtgctgctgatcatgattgccatctatgccctgctcactgagaccgtctacgcgggcctc
tttctgcgttatgacaacctcaaccacagtggagaagattttctggggaccaaggaggca
tcactgctactgatggccatgttcctcctggctgtgttctaccatggacagcagctggag
tacacagcccgcctggacttcctttggcgagtacaggccaaagaggagatcaatgagatg
aaggagctgagggaacacaatgagaacatgctccggaatatcttacccagccatgtggcc
cgccatttcctagagaaggaccgagacaatgaggagctgtattctcaatcctatgatgcc
gttggggtgatgtttgcctccatcccaggatttgcggacttttactctcagactgaaatg
aataaccagggagtggaatgcctgcgcttgctcaatgagatcattgctgacttcgatgag
ttgcttggtgaagaccgatttcaagacattgaaaagattaagaccattggcagcacctac
atggccgtgtcaggcctgtcacctgaaaaacagcaatgtgaagacaagtggggacatttg
tgtgctctggctgacttctcactcgccctgacagaaagcatacaggagatcaacaagcat
tcattcaacaattttgaactccggattggcatcagccatggctcagtggtagctggcgtt
atcggcgctaagaaaccacagtatgacatttggggcaaaactgtgaacctggcaagccga
atggacagcacgggggttagtggccggatccaagtcccagaggagacctatctcatcctg
aaggaccagggctttgcctttgattaccgaggggagatctatgtgaagggcatcagtgaa
caggaaggaaaaatcaaaacgtactttctcctgggaagagtccaacccaacccattcatc
ttgcccccaagaagactgcctgggcagtactccctggccgcggttgtcctgggacttgtc
cagtccctcaataggcaaaggcagaagcagctactcaatgagaacaacaacacaggaatc
atcaagggtcattacaaccggcggactttgttgtcacccagcgggacagagcctggagcc
caggctgaaggcaccgacaaatctgatttgccataa

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101144031
Entry
101144031         CDS       T02442                                 

Gene name
ADCY3
Definition
(RefSeq) adenylate cyclase type 3 isoform X4
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00230  Purine metabolism
ggo01100  Metabolic pathways
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04727  GABAergic synapse
ggo04740  Olfactory transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04962  Vasopressin-regulated water reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05032  Morphine addiction
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101144031 (ADCY3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101144031 (ADCY3)
   04371 Apelin signaling pathway
    101144031 (ADCY3)
   04020 Calcium signaling pathway
    101144031 (ADCY3)
   04072 Phospholipase D signaling pathway
    101144031 (ADCY3)
   04024 cAMP signaling pathway
    101144031 (ADCY3)
   04022 cGMP-PKG signaling pathway
    101144031 (ADCY3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101144031 (ADCY3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101144031 (ADCY3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101144031 (ADCY3)
   04062 Chemokine signaling pathway
    101144031 (ADCY3)
  09152 Endocrine system
   04911 Insulin secretion
    101144031 (ADCY3)
   04923 Regulation of lipolysis in adipocytes
    101144031 (ADCY3)
   04912 GnRH signaling pathway
    101144031 (ADCY3)
   04913 Ovarian steroidogenesis
    101144031 (ADCY3)
   04915 Estrogen signaling pathway
    101144031 (ADCY3)
   04914 Progesterone-mediated oocyte maturation
    101144031 (ADCY3)
   04921 Oxytocin signaling pathway
    101144031 (ADCY3)
   04926 Relaxin signaling pathway
    101144031 (ADCY3)
   04935 Growth hormone synthesis, secretion and action
    101144031 (ADCY3)
   04918 Thyroid hormone synthesis
    101144031 (ADCY3)
   04928 Parathyroid hormone synthesis, secretion and action
    101144031 (ADCY3)
   04916 Melanogenesis
    101144031 (ADCY3)
   04925 Aldosterone synthesis and secretion
    101144031 (ADCY3)
   04927 Cortisol synthesis and secretion
    101144031 (ADCY3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101144031 (ADCY3)
   04270 Vascular smooth muscle contraction
    101144031 (ADCY3)
  09154 Digestive system
   04970 Salivary secretion
    101144031 (ADCY3)
   04971 Gastric acid secretion
    101144031 (ADCY3)
   04972 Pancreatic secretion
    101144031 (ADCY3)
   04976 Bile secretion
    101144031 (ADCY3)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101144031 (ADCY3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101144031 (ADCY3)
   04727 GABAergic synapse
    101144031 (ADCY3)
   04725 Cholinergic synapse
    101144031 (ADCY3)
   04723 Retrograde endocannabinoid signaling
    101144031 (ADCY3)
  09157 Sensory system
   04740 Olfactory transduction
    101144031 (ADCY3)
   04750 Inflammatory mediator regulation of TRP channels
    101144031 (ADCY3)
  09149 Aging
   04211 Longevity regulating pathway
    101144031 (ADCY3)
   04213 Longevity regulating pathway - multiple species
    101144031 (ADCY3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101144031 (ADCY3)
   04714 Thermogenesis
    101144031 (ADCY3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101144031 (ADCY3)
  09165 Substance dependence
   05032 Morphine addiction
    101144031 (ADCY3)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101144031 (ADCY3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101144031 (ADCY3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101144031 (ADCY3)
   05163 Human cytomegalovirus infection
    101144031 (ADCY3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101144031 (ADCY3)
Enzymes [BR:ggo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101144031 (ADCY3)
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA RAP1 OPA3 Peptidase_S49_N
Other DBs
NCBI-GeneID: 101144031
NCBI-ProteinID: XP_004028977
Ensembl: ENSGGOG00000004078
LinkDB
Position
2A
AA seq 1144 aa
MPRNQGFSEPEYSAEYSAEYSVSLPSDPDRGVGRTHEISVRNSGSCLCLPRFMRLTFVPE
SLENLYQTYFKRQRHETLLVLVVFAALFDCYVVVMCAVVFSSDKLAPLAVAGIGLVLDII
LFVLCKKGLLPDRVTRRVVPYVLWLLITAQIFSYLGLNFARAHAASDTVGWQVFFVFSFF
ITLPLSLSPIVIISVVSCVVHTLVLGVTVAQQQQEELKGMQLLREILANVFLYLCAIAVG
IMSYYMADRKHRKAFLEARQSLEVKMNLEEQSQQQENLMLSILPKHVADEMLKDMKKDES
QKDQQQFNTMYMYRHENVSILFADIVGFTQLSSACSAQELVKLLNELFARFDKLAAKYHQ
LRIKILGDCYYCICGLPDYREDHAVCSILMGLAMVEAISYVREKTKTGVDMRVGVHTGTV
LGGVLGQKRWQYDVWSTDVTVANKMEAGGIPGRVHISQSTMDCLKGEFDVEPGDGGSRCD
YLEEKGIETYLIIASKPEVKKTATQNGLNGSALPNGAPASSKSSSPALIETKEPNGSAHS
SGSTSEKPEEQDAQADNPSFPNPRRRLRLQDLADRVVDASEDEHELNQLLNEALLERESA
QVVKKRNTFLLSMRFMDPEMETRYSVEKEKQSGAAFSCSCVVLLCTALVEILIDPWLMTN
YVTFMVGEILLLILTICSLAAIFPRAFPKKLVAFSTWIDRTRWARNTWAMLAIFILVMAN
VVDMLSCLQYYTGPGNATAGMETEGGCLENPKYYNYVAVLSLIATIMLVQVSHMVKLTLM
LLVAGAVATINLYAWRPVFDEYDHKRFREHDLPMVALEQMQGFNPGLNGTDRLPLVPSKY
SMTVMVFLMMLSFYYFSRHVEKLARTLFLWKIEVHDQKERVYEMRRWNEALVTNMLPEHV
ARHFLGSKKRDEELYSQTYDEIGVMFASLPNFADFYTEESINNGGIECLRFLNEIISDFD
SLLDNPKFRVITKIKTIGSTYMAASGVTPDVNTNGFASSNKEDKSERERWQHLADLADFA
LAMKDTLTNINNQSFNNFMLRIGMNKGGVLAGVIGARKPHYDIWGNTVNVASRMESTGVM
GNIQVVEETQVILREYGFRFVRRGPIFVKGKGELLTFFLKGRDKLATFPNGPSVTLPHQV
VDNS
NT seq 3435 nt   +upstreamnt  +downstreamnt
atgccgaggaaccagggcttctccgagcccgaatactcggccgagtactcagccgagtac
tccgtcagcctgccctccgaccctgaccgcggggtgggccggacccatgaaatctcggtc
cggaactcgggctcctgcctgtgcctgcctcgcttcatgcggctgactttcgtgccggag
tccttggagaacctctaccagacctacttcaaaaggcagcgccacgagaccctgctggtg
ctggtggtctttgcagccctctttgactgctacgtggtggtcatgtgtgctgtggtcttc
tccagcgacaagctagctcccctcgccgtggctggaattggactggtgttggacatcatc
ctcttcgtgctctgcaaaaaggggctgctcccggaccgggtcacccgcagagtggtgccc
tacgtgctgtggctgctcataaccgcccagatcttctcctacctgggcctgaacttcgcg
cgtgcccacgcggctagtgacacggtgggctggcaggtcttctttgtcttctccttcttc
atcacgctgcccctcagcctcagccccatcgtgatcatctccgtggtctcctgtgtggtg
cacacgttggtcctgggggtcaccgtggcccagcagcagcaggaggagctcaaggggatg
cagctgctgcgggagatcctggccaacgtcttcctctacctgtgcgccatcgctgtgggc
atcatgtcctactacatggctgaccgcaagcaccgcaaggccttcctggaggcccgccag
tcgctggaggtgaagatgaacctggaagagcagagccagcagcaggagaacctcatgctt
tccatcctgcccaagcacgtggctgacgagatgctgaaagacatgaagaaagacgagagc
cagaaggaccagcagcagttcaacaccatgtacatgtaccgtcacgagaacgtcagcatc
ctctttgccgacatcgtgggctttacccagctgtcttctgcctgcagtgcccaggagctt
gtgaagctgctcaacgagctctttgcccgctttgacaagctggcagctaaataccaccag
ctgcggattaagatcctgggcgactgctactactgcatctgcggcttgcctgactaccgg
gaggaccacgccgtctgctccatcctcatggggctggccatggtggaggccatctcgtat
gtgcgggagaagaccaagactggggtggacatgcgtgtgggggtgcacacgggcaccgtg
ctggggggcgtcctgggccagaagcgctggcagtacgatgtgtggtcgactgatgtcact
gtagccaacaagatggaggccggcggcatccctgggcgcgtgcacatctcccagagcacc
atggactgcctgaaaggggagtttgatgtggagccaggcgatgggggcagccgctgtgat
tacctagaagagaagggtattgaaacctacctcatcattgcctccaagccagaggtgaag
aaaacagccacccagaatggcctcaatggctcggccctgcccaatggagcgccagcttcc
tcaaagtccagctcccctgccctcattgagaccaaggagcccaatgggagtgcccacagc
agcgggtccacgtcggagaagcctgaggagcaggatgcccaggccgacaacccctcattc
cccaacccacgccggaggctgcgcctgcaggacctggctgaccgagtggtggatgcctct
gaagatgagcacgagctcaaccagctgctcaacgaggccctgcttgagcgagagtccgcc
caagtagtaaagaagagaaacaccttcctcttgtccatgcggttcatggaccctgagatg
gaaacccgctattcggtggagaaggagaagcagagtggggctgccttcagctgctcctgc
gtcgtcctgctctgcacggctctggtcgagatactcatcgacccctggctaatgacaaac
tatgtgaccttcatggtgggggagattctgctcctcatcctgaccatctgctccctggct
gccatctttccccgggcctttcctaagaagcttgtggccttctcaacttggattgaccgg
acccgctgggccaggaacacctgggccatgctcgccatcttcatcctggtgatggcaaat
gtcgtggacatgctcagctgtctccagtactacacgggacccggcaacgcaacggcaggg
atggagacggagggtggctgcctggagaaccccaagtattacaactatgtggccgtgctg
tccctcatcgccaccatcatgctggtgcaggtcagccacatggtgaagctcacgctcatg
ctgctcgtcgcaggcgccgtggccaccatcaacctctatgcctggcgccccgtctttgat
gaatacgaccacaagcgttttcgggagcacgacttacctatggtggccttagagcagatg
caaggattcaaccctgggctcaatggcactgacaggctgcccctggtgccttccaagtac
tctatgacggtgatggtgttcctcatgatgctcagcttctactacttctcccgccacgta
gaaaaactggcacggacacttttcttgtggaagattgaggtccacgaccagaaggaacgt
gtctacgagatgcgacgctggaacgaggccttggtcaccaacatgttgcctgagcacgtg
gcacgccatttcctggggtccaagaagagagatgaggagctgtatagccagacgtatgat
gagattggagtcatgtttgcctccctgcccaactttgctgacttctacacagaggagagc
atcaacaatggtggtattgagtgtctgcgtttcctcaatgaaatcatctcggattttgac
tctctcctggacaatcccaagttccgagtgatcaccaagatcaaaaccattggcagcacg
tatatggcggcttcaggagtcacccccgatgtcaacaccaatggctttgccagctccaac
aaggaagacaagtccgagagagagcgctggcagcacctggctgacctggccgacttcgcg
ctggccatgaaggatacgctcaccaacatcaacaaccagtccttcaataacttcatgctg
cgcataggcatgaacaaaggcggggttctggctggggtcattggagcccggaaaccacac
tacgacatctggggcaatacagtcaatgtagccagcaggatggagtccacgggggtcatg
ggcaacattcaggtggtagaagaaacccaagtcatcctccgagagtacggcttccgcttt
gtgaggcgaggccccatctttgtgaaggggaagggggagctgctgaccttcttcttgaag
gggcgggataagctagccaccttccccaatggcccctctgtcacactgccccaccaggtg
gtggacaactcctga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101145410
Entry
101145410         CDS       T02442                                 

Gene name
ADCY9
Definition
(RefSeq) adenylate cyclase type 9
  KO
K08049  adenylate cyclase 9 [EC:4.6.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00230  Purine metabolism
ggo01100  Metabolic pathways
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04727  GABAergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04962  Vasopressin-regulated water reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05032  Morphine addiction
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101145410 (ADCY9)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101145410 (ADCY9)
   04371 Apelin signaling pathway
    101145410 (ADCY9)
   04020 Calcium signaling pathway
    101145410 (ADCY9)
   04072 Phospholipase D signaling pathway
    101145410 (ADCY9)
   04024 cAMP signaling pathway
    101145410 (ADCY9)
   04022 cGMP-PKG signaling pathway
    101145410 (ADCY9)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101145410 (ADCY9)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101145410 (ADCY9)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101145410 (ADCY9)
   04062 Chemokine signaling pathway
    101145410 (ADCY9)
  09152 Endocrine system
   04911 Insulin secretion
    101145410 (ADCY9)
   04923 Regulation of lipolysis in adipocytes
    101145410 (ADCY9)
   04912 GnRH signaling pathway
    101145410 (ADCY9)
   04913 Ovarian steroidogenesis
    101145410 (ADCY9)
   04915 Estrogen signaling pathway
    101145410 (ADCY9)
   04914 Progesterone-mediated oocyte maturation
    101145410 (ADCY9)
   04921 Oxytocin signaling pathway
    101145410 (ADCY9)
   04926 Relaxin signaling pathway
    101145410 (ADCY9)
   04935 Growth hormone synthesis, secretion and action
    101145410 (ADCY9)
   04918 Thyroid hormone synthesis
    101145410 (ADCY9)
   04928 Parathyroid hormone synthesis, secretion and action
    101145410 (ADCY9)
   04916 Melanogenesis
    101145410 (ADCY9)
   04925 Aldosterone synthesis and secretion
    101145410 (ADCY9)
   04927 Cortisol synthesis and secretion
    101145410 (ADCY9)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101145410 (ADCY9)
   04270 Vascular smooth muscle contraction
    101145410 (ADCY9)
  09154 Digestive system
   04970 Salivary secretion
    101145410 (ADCY9)
   04971 Gastric acid secretion
    101145410 (ADCY9)
   04972 Pancreatic secretion
    101145410 (ADCY9)
   04976 Bile secretion
    101145410 (ADCY9)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101145410 (ADCY9)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101145410 (ADCY9)
  09156 Nervous system
   04724 Glutamatergic synapse
    101145410 (ADCY9)
   04727 GABAergic synapse
    101145410 (ADCY9)
   04725 Cholinergic synapse
    101145410 (ADCY9)
   04723 Retrograde endocannabinoid signaling
    101145410 (ADCY9)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101145410 (ADCY9)
  09149 Aging
   04211 Longevity regulating pathway
    101145410 (ADCY9)
   04213 Longevity regulating pathway - multiple species
    101145410 (ADCY9)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101145410 (ADCY9)
   04714 Thermogenesis
    101145410 (ADCY9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101145410 (ADCY9)
  09165 Substance dependence
   05032 Morphine addiction
    101145410 (ADCY9)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101145410 (ADCY9)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101145410 (ADCY9)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101145410 (ADCY9)
   05163 Human cytomegalovirus infection
    101145410 (ADCY9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101145410 (ADCY9)
Enzymes [BR:ggo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101145410 (ADCY9)
SSDB
Motif
Pfam: Guanylate_cyc DUF512 DUF1053 zf-C2HC_2 AC_N
Other DBs
NCBI-GeneID: 101145410
NCBI-ProteinID: XP_004057148
Ensembl: ENSGGOG00000000671
UniProt: G3QEG6
LinkDB
Position
16
AA seq 1353 aa
MASPPHQQLLHHHSTEVSCDSSGDSNSVRVKINPKQLSSNSHPKHCKYSISSSCSSSGDS
GGVPRRVGGGGRLRRQKKLPQLFERASSRWWDPKFDSVNLEEACLERCFPQTQRRFRYAL
FYIGFACLLWSIYFAVHMRSRLIVMVAPALCFLLVCVGFFLFTFTKLYARHYAWTSLALT
LLVFALTLAAQFQVLTPVSGRGDSSNLTATARPTDTCLSQVGSFSMCIEVLFLLYTVMHL
PLYLSLCLGVAYSVLFETFGYHFRDEACFPSPGAGALHWELLSRALLHGCIHAIGVHLFV
MSQVRSRSTFLKVGQSIMHGKDLEVEKALKERMIHSVMPRIIADDLMKQGDEESENSVKR
HATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLN
DLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEK
KEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLD
DRYEMEDGKVIERLGQSVVADQLKGLKTYLISGQRAKESRCSCAEALLSGFEVIDGSQVS
SGPRGQGTASSGNVSDLAQTVKTFDNLKTCPSCGITFAPKSEAGAEGGAPQNGCQDEHKN
STKASGGPNPKTQNGLLSPPQEEKLTNSQTSLCEILQEKGRWAGVSLDQSALLPLRFKNI
REKTDAHFVDVIKEDSLMKDYFFKPPINQFSLNFLDQGLERSYRTSYQEEVIKNSPVKTF
ASPTFSSLLDVFLSTTVFLTLSTTCFLKYEAATVPPPPAALAVFSAALLLEVLSLAVSIR
MVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHVTSEYETNIHFPVFTGS
AALIAVVHYCNFCQLSSWMRSSLATVVGAGPLLLLYVSLCPDSSVLTSPLDAVQNFSSER
NPCNSSVPRDLRRPASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTK
IQSMRDQADWLLRNIIPYHVAEQLKVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKE
CYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFE
FAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTT
GVECRIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYLYPKCTDHGVIPQHQLSISP
DIRVQVDGSIGRSPTDEIANLVPSVQYVDKTSLGSDSSTQAKDAHLSPKRPWKEPVKAEE
RGQFGKAIEKYDCDETGIEEANELTKLNVSKSV
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggcttccccgccccaccagcagctactgcatcaccacagcaccgaggtgagctgcgac
tccagcggggacagcaacagcgtgcgcgtcaagatcaaccccaagcagctgtcctccaac
agccaccccaagcactgcaaatacagcatctcctctagctgcagcagctctggggactcc
gggggcgtcccccggcgagtgggcggcggaggccggctgcgcaggcagaagaagctgccc
cagctgttcgagagggcctccagccgctggtgggaccccaagttcgactcggtgaacctg
gaggaggcttgcctggagcgctgcttcccgcaaacccagcgccggttccggtatgcgctc
ttctacatcggcttcgcctgccttctgtggagcatctattttgcggtccacatgagatcc
agactgatcgtcatggtcgcccccgcgctgtgcttcctcctggtgtgtgtgggcttcttt
ctgtttaccttcaccaagctgtacgcccggcattacgcgtggacctcgctggctctcacc
ctgctggtgttcgccctgaccctggctgcgcagttccaggtcttgacgcctgtctcagga
cgcggcgacagctccaaccttacggccacagcccggcccacagatacttgcttatctcaa
gtggggagcttctccatgtgcatcgaagtgctctttttgctctataccgtcatgcactta
cctttgtacctgagcttgtgtctgggggtggcctactctgtccttttcgagacctttggc
taccatttccgggatgaagcctgcttcccctcgcccggagccggggccctgcactgggag
ctgctgagcagggcgctgctccacggctgcatccacgccatcggggtccacctgttcgtc
atgtcccaggtgaggtccaggagcaccttcctcaaggtagggcaatccattatgcacggg
aaggacctggaagtggaaaaagccctcaaagagaggatgattcattccgtgatgccaaga
atcatagccgatgacttaatgaagcagggagatgaggagagtgagaattctgtcaagagg
catgccacctcgagccccaagaacaggaagaaaaagtcttccatccagaaagctcctata
gccttccgcccttttaagatgcagcagatcgaagaagtcagtattttatttgcagatatc
gtgggcttcaccaagatgagtgccaacaagtccgcccacgccctggtgggtctcctgaac
gatctgttcggtcgcttcgaccgcctgtgtgaggagaccaagtgtgagaaaatcagcact
ctgggagactgttactactgcgtggcgggctgtcccgagccccgggccgaccatgcctac
tgctgcatcgagatgggcctgggcatgatcaaggccatcgagcagttctgccaggagaag
aaggagatggtgaacatgagagtcggggtgcacacgggcaccgtcctttgcggcatcctg
ggcatgaggaggtttaaatttgacgtgtggtccaacgatgtgaacctggccaatctcatg
gagcagctgggagtggccggcaaagttcacatttctgaggccaccgcaaaatacttagat
gaccggtacgaaatggaagatgggaaagttattgaacggctgggccagagcgtggttgct
gaccagttgaaaggtttgaagacatacctgatatcgggtcagagagccaaggagtctcgc
tgcagctgtgcagaggccttgctttctggctttgaggtcattgacggctcacaggtgtcc
tcaggccctaggggacaggggacagcgtcatcagggaatgtcagtgacttggcgcagact
gtcaaaacctttgataaccttaagacctgcccttcgtgcggaatcacatttgctcccaaa
tctgaagccggcgccgagggaggagcacctcaaaacggctgccaagacgagcataaaaac
agcaccaaggcttctggaggacctaatcccaaaactcagaacgggctcctgagccctccc
caagaggagaagctcaccaacagtcagacttctctgtgtgagatcttgcaggagaaggga
aggtgggcaggggtgagcctggaccagtcggctctccttccgctgaggttcaagaacatc
cgggagaaaacggacgcccactttgtggacgttatcaaagaagacagcctgatgaaagat
tacttttttaagccgcccattaatcagttcagcctgaacttcctggatcaggggctggag
cgatcctacaggaccagctatcaggaagaggtcataaagaactcccccgtgaagacgttt
gctagtcccaccttcagctccctcctggatgtgtttctgtcgaccacagtgtttctgacg
ctgtccaccacctgcttcctgaagtacgaggcagccaccgtgcctcccccgcccgccgcc
ctggcggtcttcagtgcagccctgctgctggaggtgctgtccctcgcggtgtccatcagg
atggtgttcttcctggaggacgtcatggcctgcaccaagcgcctgctggagtggatcgcc
ggctggctaccacgtcactgcatcggggccatcctggtgtcgctccccgcactggccgtc
tactcccatgttacctccgaatatgagaccaacatacacttcccagtgttcacaggctcg
gccgcgctgattgccgtcgtgcactactgtaacttctgccagctcagctcctggatgagg
tcctcccttgccaccgttgtgggggccgggccgctgctcctgctctacgtctccctgtgc
ccagacagttctgtattaacttcgccccttgacgcagtacagaatttcagttccgagagg
aacccgtgcaatagctcggtgccgcgtgacctccggcggccggccagcctcatcggccag
gaggtggttctcgtcttctttctcctgctcttgttggtctggttcctgaatcgcgaattt
gaagtcagctaccgcctccactaccacggagacgtggaagcggatcttcaccgcaccaag
atccagagcatgcgggaccaggcagactggctgctgaggaacatcatcccctaccacgtg
gctgagcagctgaaggtgtcccagacctactccaagaaccacgacagcggaggggtgatc
ttcgccagcatcgtcaacttcagcgagttctacgaggagaactacgagggcggcaaggag
tgctaccgggtcctcaacgagctcatcggggactttgacgagctcctaagcaagccggac
tacagcagcatcgagaagatcaagaccatcggagccacgtacatggcggcgtcagggctg
aacaccgcgcaggcccaggacggcagccacccgcaggagcacctgcagatcctgttcgag
tttgccaaggagatgatgcgcgtggtggacgacttcaacaacaacatgctgtggttcaac
ttcaagctccgcgtcggcttcaaccatgggcccctcacggccggggtcatcggcaccacc
aagctgctgtatgacatctggggagacaccgtcaacatcgccagcaggatggacaccact
ggcgtggagtgccgcatccaggtgagcgaagagagctaccgcgtcttgagcaagatgggc
tatgacttcgactacagagggaccgtgaatgtcaaggggaaaggccagatgaagacctac
ctgtacccaaagtgcacggatcacggggtcatcccacagcaccagctgtccatctcccca
gacatccgcgtccaggtggatggcagcatcggacggtctcccacagacgagattgccaac
ctggtgccttctgtccagtatgtggacaagacatctctgggttctgacagcagcacgcag
gccaaggatgcccacctgtcccccaagagaccgtggaaggagcccgtcaaagccgaagaa
aggggtcaatttggcaaagccatagagaaatacgactgtgatgaaacaggaatagaagaa
gccaacgaactcaccaagctcaacgtttcaaagagtgtgtga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101150181
Entry
101150181         CDS       T02442                                 

Gene name
ADCY5
Definition
(RefSeq) adenylate cyclase type 5 isoform X2
  KO
K08045  adenylate cyclase 5 [EC:4.6.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00230  Purine metabolism
ggo01100  Metabolic pathways
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04114  Oocyte meiosis
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04727  GABAergic synapse
ggo04728  Dopaminergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05012  Parkinson disease
ggo05030  Cocaine addiction
ggo05031  Amphetamine addiction
ggo05032  Morphine addiction
ggo05034  Alcoholism
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101150181 (ADCY5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101150181 (ADCY5)
   04371 Apelin signaling pathway
    101150181 (ADCY5)
   04072 Phospholipase D signaling pathway
    101150181 (ADCY5)
   04024 cAMP signaling pathway
    101150181 (ADCY5)
   04022 cGMP-PKG signaling pathway
    101150181 (ADCY5)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101150181 (ADCY5)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101150181 (ADCY5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101150181 (ADCY5)
   04062 Chemokine signaling pathway
    101150181 (ADCY5)
  09152 Endocrine system
   04911 Insulin secretion
    101150181 (ADCY5)
   04923 Regulation of lipolysis in adipocytes
    101150181 (ADCY5)
   04912 GnRH signaling pathway
    101150181 (ADCY5)
   04913 Ovarian steroidogenesis
    101150181 (ADCY5)
   04915 Estrogen signaling pathway
    101150181 (ADCY5)
   04914 Progesterone-mediated oocyte maturation
    101150181 (ADCY5)
   04921 Oxytocin signaling pathway
    101150181 (ADCY5)
   04926 Relaxin signaling pathway
    101150181 (ADCY5)
   04935 Growth hormone synthesis, secretion and action
    101150181 (ADCY5)
   04918 Thyroid hormone synthesis
    101150181 (ADCY5)
   04928 Parathyroid hormone synthesis, secretion and action
    101150181 (ADCY5)
   04916 Melanogenesis
    101150181 (ADCY5)
   04924 Renin secretion
    101150181 (ADCY5)
   04925 Aldosterone synthesis and secretion
    101150181 (ADCY5)
   04927 Cortisol synthesis and secretion
    101150181 (ADCY5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101150181 (ADCY5)
   04270 Vascular smooth muscle contraction
    101150181 (ADCY5)
  09154 Digestive system
   04970 Salivary secretion
    101150181 (ADCY5)
   04971 Gastric acid secretion
    101150181 (ADCY5)
   04972 Pancreatic secretion
    101150181 (ADCY5)
   04976 Bile secretion
    101150181 (ADCY5)
  09156 Nervous system
   04724 Glutamatergic synapse
    101150181 (ADCY5)
   04727 GABAergic synapse
    101150181 (ADCY5)
   04725 Cholinergic synapse
    101150181 (ADCY5)
   04728 Dopaminergic synapse
    101150181 (ADCY5)
   04726 Serotonergic synapse
    101150181 (ADCY5)
   04723 Retrograde endocannabinoid signaling
    101150181 (ADCY5)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101150181 (ADCY5)
  09149 Aging
   04211 Longevity regulating pathway
    101150181 (ADCY5)
   04213 Longevity regulating pathway - multiple species
    101150181 (ADCY5)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101150181 (ADCY5)
   04714 Thermogenesis
    101150181 (ADCY5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101150181 (ADCY5)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101150181 (ADCY5)
  09165 Substance dependence
   05030 Cocaine addiction
    101150181 (ADCY5)
   05031 Amphetamine addiction
    101150181 (ADCY5)
   05032 Morphine addiction
    101150181 (ADCY5)
   05034 Alcoholism
    101150181 (ADCY5)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101150181 (ADCY5)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101150181 (ADCY5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101150181 (ADCY5)
   05163 Human cytomegalovirus infection
    101150181 (ADCY5)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101150181 (ADCY5)
Enzymes [BR:ggo01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     101150181 (ADCY5)
SSDB
Motif
Pfam: Guanylate_cyc DUF1053 AC_N TBK1_ULD HILPDA GBR2_CC
Other DBs
NCBI-GeneID: 101150181
NCBI-ProteinID: XP_018880081
LinkDB
Position
3
AA seq 820 aa
MEMKADINAKQEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARF
DKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGMDMIEAISLVREVTGVNVNM
RVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLNYLNGDYEVE
PGCGGERNAYLKEHSIETFLILRCTQKRKEEKAMIAKMNRQRTNSIGHNPPHWGAERPFY
NHLGGNQVSKEMKRMGFEDPKDKNAQESANPEDEVDEFLGRAIDARSIDRLRSEHVRKFL
LTFREPDLEKKYSKQVDDRFGAYVACASLVFLFICFVQITIVPHSVFMLSFYLTCSLLLT
LVVFVSVIYSCVKLFPSPLQTLSRKIVRSKMNSTLVGVFTITLVFLAAFVNMFTCNSRDL
LGCLAQEHNISASQVNACHVAESAVNYSLGDEQGFCGSPWPNCNFPEYFTYSVLLSLLAC
SVFLQISCIGKLVLMLAIELIYVLIVEVPGVMLFDNADLLVTANAIDFFNNGTSQCPEHA
TKVALKVVTPIIISVFVLALYLHAQQVESTARLDFLWKLQATEEKEEMEELQAYNRRLLH
NILPKDVAAHFLARERRNDELYYQSCECVAVMFASIANFSEFYVELEANNEGVECLRLLN
EIIADFDEIISEDRFRQLEKIKTIGSTYMAASGLNDSTYDKVGKTHIKALADFAMKLMDQ
MKYINEHSFNNFQMKIGLNIGPVVAGVIGARKPQYDIWGNTVNVASRMDSTGVPDRIQVT
TDMYQVLAANTYQLECRGVVKVKGKGEMMTYFLNGGPPLS
NT seq 2463 nt   +upstreamnt  +downstreamnt
atggagatgaaagcagacatcaacgccaagcaggaggatatgatgttccataagatttac
atccagaaacatgacaacgtgagcatcctgtttgctgacatcgagggcttcaccagcctg
gcatcccagtgcactgcacaggaactggtcatgaccctcaacgagctcttcgcccgcttt
gacaagctggccgcagagaatcactgtttacgtattaagatcctcggggattgttattac
tgcgtctcggggctgcctgaagcaagggctgaccacgcccactgctgtgtggagatgggc
atggacatgatcgaggccatctcgttggtccgggaggtgacaggggtgaacgtgaacatg
cgtgtgggaattcacagcgggcgagtacactgcggtgtccttggtctcaggaagtggcag
ttcgacgtctggtctaacgatgtcacgctagccaaccacatggaggctggcggcaaggcg
ggacgcatccacatcaccaaggctacactcaactacctgaatggggactacgaggtggag
ccaggctgtgggggcgagcgcaacgcctacctcaaggagcacagtatcgagaccttcctc
atcctgcgctgcacccagaagcggaaagaagagaaggccatgatcgccaagatgaaccgc
cagagaaccaactccatcgggcacaacccaccacactggggggctgagcgccccttctac
aaccacctgggtggcaaccaggtgtccaaggagatgaagcggatgggctttgaagacccc
aaggacaagaacgcccaggagagtgcgaatcctgaggatgaagtggatgagtttctgggc
cgtgccattgacgccaggagcatcgataggcttcggtctgagcacgtccgcaagttcctc
ctgaccttcagggagcctgacttagagaagaagtactccaagcaggtagacgaccgattt
ggtgcctatgtggcgtgtgcctcgctcgtcttcctcttcatctgctttgtccagatcacc
atcgtgccccactccgtattcatgctcagcttctacctgacctgttccctgctgctgacc
ttggtggtgtttgtgtctgtgatctactcctgcgtaaagctcttcccctccccactgcag
accctctccaggaagatcgtgcggtccaagatgaacagcaccctggttggggtgttcacc
atcaccctggtgttcctggcggcttttgtcaacatgttcacgtgcaactccagggacctg
ctgggctgcttggcacaggagcacaacatcagcgcgagccaggtcaacgcgtgtcacgtg
gcggagtcggccgtcaactacagcctgggcgatgagcagggcttctgtggcagcccctgg
cccaactgcaacttccccgagtacttcacctacagcgtgctgctcagcctgctggcctgc
tccgtgttcctgcagatcagctgcatcgggaagctggtgctcatgctggccatcgagctc
atctacgtgctcatcgtggaggtgccaggtgtcatgctcttcgacaacgccgacctgctg
gtcaccgccaatgccatagacttcttcaacaacgggacctcccagtgccctgagcacgca
accaaggtggcattgaaggtggtgacgcccatcatcatctcagtctttgtgctggccctg
tacctgcacgcccagcaggtggagtccactgcccgcctcgacttcctctggaaactgcag
gccacagaggagaaggaggagatggaggagctgcaggcctacaaccggcggctgctgcac
aacatcctgcccaaggacgtggccgctcacttcctggcccgcgagcggcgcaatgatgag
ctctactatcagtcctgtgagtgtgtggctgtcatgttcgcctccatcgccaacttctcc
gagttctacgttgagctggaggccaacaacgaaggtgtcgagtgcctgcggctactcaat
gagatcatcgctgactttgatgagatcatcagcgaggatcggttccggcagctggagaag
atcaagaccatcggcagcacctacatggctgcctccggcctcaacgactctacctacgac
aaggtgggcaagacccacatcaaggcactggccgactttgccatgaagctgatggaccag
atgaagtacatcaatgagcactccttcaacaacttccagatgaagatcgggctcaacatc
ggccccgtggtggccggggtgataggggcacgaaagcctcagtacgacatctggggcaat
accgtgaacgtggccagccgcatggacagcaccggtgtacccgaccgcatccaggtcacc
acagacatgtaccaggtgctggctgccaacacgtaccagctggagtgccggggcgtggtc
aaggtcaagggcaaaggcgagatgatgacctacttcctcaatggagggcccccgctcagt
tag

DBGET integrated database retrieval system