KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126190
Entry
101126190         CDS       T02442                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01521  EGFR tyrosine kinase inhibitor resistance
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04144  Endocytosis
ggo04151  PI3K-Akt signaling pathway
ggo04510  Focal adhesion
ggo04520  Adherens junction
ggo04540  Gap junction
ggo04630  JAK-STAT signaling pathway
ggo04810  Regulation of actin cytoskeleton
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04926  Relaxin signaling pathway
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo05160  Hepatitis C
ggo05163  Human cytomegalovirus infection
ggo05165  Human papillomavirus infection
ggo05171  Coronavirus disease - COVID-19
ggo05200  Pathways in cancer
ggo05205  Proteoglycans in cancer
ggo05206  MicroRNAs in cancer
ggo05210  Colorectal cancer
ggo05212  Pancreatic cancer
ggo05213  Endometrial cancer
ggo05214  Glioma
ggo05215  Prostate cancer
ggo05218  Melanoma
ggo05219  Bladder cancer
ggo05223  Non-small cell lung cancer
ggo05224  Breast cancer
ggo05225  Hepatocellular carcinoma
ggo05226  Gastric cancer
ggo05230  Central carbon metabolism in cancer
ggo05231  Choline metabolism in cancer
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101126190 (EGFR)
   04012 ErbB signaling pathway
    101126190 (EGFR)
   04014 Ras signaling pathway
    101126190 (EGFR)
   04015 Rap1 signaling pathway
    101126190 (EGFR)
   04630 JAK-STAT signaling pathway
    101126190 (EGFR)
   04066 HIF-1 signaling pathway
    101126190 (EGFR)
   04068 FoxO signaling pathway
    101126190 (EGFR)
   04020 Calcium signaling pathway
    101126190 (EGFR)
   04072 Phospholipase D signaling pathway
    101126190 (EGFR)
   04151 PI3K-Akt signaling pathway
    101126190 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101126190 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101126190 (EGFR)
   04520 Adherens junction
    101126190 (EGFR)
   04540 Gap junction
    101126190 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101126190 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101126190 (EGFR)
   04915 Estrogen signaling pathway
    101126190 (EGFR)
   04921 Oxytocin signaling pathway
    101126190 (EGFR)
   04926 Relaxin signaling pathway
    101126190 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    101126190 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101126190 (EGFR)
   05206 MicroRNAs in cancer
    101126190 (EGFR)
   05205 Proteoglycans in cancer
    101126190 (EGFR)
   05230 Central carbon metabolism in cancer
    101126190 (EGFR)
   05231 Choline metabolism in cancer
    101126190 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101126190 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101126190 (EGFR)
   05212 Pancreatic cancer
    101126190 (EGFR)
   05225 Hepatocellular carcinoma
    101126190 (EGFR)
   05226 Gastric cancer
    101126190 (EGFR)
   05214 Glioma
    101126190 (EGFR)
   05218 Melanoma
    101126190 (EGFR)
   05219 Bladder cancer
    101126190 (EGFR)
   05215 Prostate cancer
    101126190 (EGFR)
   05213 Endometrial cancer
    101126190 (EGFR)
   05224 Breast cancer
    101126190 (EGFR)
   05223 Non-small cell lung cancer
    101126190 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101126190 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101126190 (EGFR)
   05171 Coronavirus disease - COVID-19
    101126190 (EGFR)
   05163 Human cytomegalovirus infection
    101126190 (EGFR)
   05165 Human papillomavirus infection
    101126190 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101126190 (EGFR)
   01522 Endocrine resistance
    101126190 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101126190 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101126190 (EGFR)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     101126190 (EGFR)
Protein kinases [BR:ggo01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   101126190 (EGFR)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   101126190 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   101126190 (EGFR)
  Exosomal proteins of bladder cancer cells
   101126190 (EGFR)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like Kinase-like APH GAPT Kdo
Other DBs
NCBI-GeneID: 101126190
NCBI-ProteinID: XP_030868665
Ensembl: ENSGGOG00000007623
LinkDB
Position
7
AA seq 1210 aa
MRPSGTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVV
ALGIGLFMRRRHIIRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ
QGFFSSPSTSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTED
SIDDTFLPVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLN
TVQPTCVNSTFDGPSHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRV
APQSSEFIGA
NT seq 3633 nt   +upstreamnt  +downstreamnt
atgcgaccctccgggaccgccggggcagcgctcctggcgctgctggctgcgctctgcccg
gcgagtcgggctctggaggaaaagaaagtttgccaaggcacgagtaacaagctcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatttggaaattacctatgtgcagaggaattatgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcattgccctcaacacagtggagcggattcct
ttagaaaacctgcagatcatcagaggaaatatgtactacgaaaattcctacgccttagca
gtcttatctaactatgatgcaaataaaaccggactgaaggagctgcccatgagaaattta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagtgactttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaagctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctcc
gggcgctgccgtggcaagtcccccagtgactgctgccacaaccagtgtgccgcaggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacgtaccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgtggggccgacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaacggaata
ggtattggtgaatttaaagacacactctccataaatgctacgaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacatactccgcctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggacctccatgctttt
gagaacctagaaatcatacgcggcaggaccaagcaacatggtcagttttctcttgcggtc
gtcagcctgaacataacatccttgggattacgctccctcaaggagataagtgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccggtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacaggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcttgccggaatgtcagccgaggcagggaatgcgtggacaagtgcaac
attctggagggcgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gagtgcctgcctcaggccatgaacatcacctgcacaggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccggcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagatgccggccatgtgtgccacctgtgc
catccaaactgcacctacggatgcactgggccaggtcttgaaggctgtccaacgaatggg
cctaagatcccgtccattgccactgggatggtgggggccctcctcttgctgctggtggtg
gccctggggattggcctcttcatgcgaaggcgccacatcattcggaagcgcacgctgcgg
aggctgctgcaggagagggagcttgtggagcctcttacacccagtggagaagctcccaac
caagctctcttgaggatcttgaaggaaactgaattcaaaaagatcaaagtgctgggctcc
ggcgcgttcggcacggtgtataagggactctggatcccagaaggtgagaaagttaaaatt
cccgtcgctatcaaggaattaagagaagcaacgtctccgaaagccaacaaggaaatcctc
gatgaagcctacgtgatggccagcgtggacaacccccacgtgtgccgcctgctgggcatc
tgcctcacctccaccgtgcagctcatcacgcagctcatgcccttcggctgcctcctggac
tatgtccgggaacacaaagacaatattggctcccagtacctgctcaactggtgtgtgcag
atcgcaaagggcatgaactacttggaggaccgtcgcttggtgcaccgcgacctggcagcc
aggaacgtactggtgaaaacaccgcagcatgtcaagatcacagattttgggctggccaaa
ctgctgggtgcagaagagaaagaataccatgcagaaggaggcaaagtgcctatcaagtgg
atggcattggaatcaattttacacagaatctatacccaccagagtgatgtctggagctac
ggggtgaccgtttgggagttgatgacctttggatccaagccatatgacggaatccctgcc
agcgagatctcctccatcctggagaaaggagaacgcctccctcagccacccatatgtacc
atcgatgtctacatgatcatggtcaaatgctggatgatagacgcagatagtcgcccaaag
ttccgtgagttgatcatcgaattctccaaaatggcccgagacccccagcgctaccttgtc
attcagggggatgaaagaatgcatttgccaagccctacagactccaacttctaccgtgcc
ctgatggatgaagaagacatggacgatgtggtggatgccgacgagtacctcatcccacag
cagggcttcttcagcagcccctccacgtcacggactcccctcctgagctctctgagtgca
accagcaacaattccactgtggcttgcattgatagaaatgggctgcaaagctgtcccatc
aaggaagacagcttcttgcagcgatacagctcagaccccacaggcgccttgactgaggac
agcatagacgacaccttcctcccagtgcctgaatacataaaccagtccgttcccaaaagg
cccgctggctctgtgcagaatcctgtctatcacaatcagcctctgaaccccgcacccagc
agagacccacactaccaggacccccacagcactgcagtgggcaaccccgagtatctcaac
actgtccagcccacctgtgtcaacagcacattcgacggcccttcccactgggcccagaaa
ggcagccaccaaattagcctggacaaccctgactaccagcaggacttctttcccaaggaa
gccaagccaaatggcatctttaagggctccacagctgaaaatgcagaatacctaagggtc
gcgccacaaagcagtgaatttattggagcatga

DBGET integrated database retrieval system