KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126640
Entry
101126640         CDS       T02442                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1 isoform X1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo01524  Platinum drug resistance
ggo04012  ErbB signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04110  Cell cycle
ggo04115  p53 signaling pathway
ggo04151  PI3K-Akt signaling pathway
ggo04218  Cellular senescence
ggo04630  JAK-STAT signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo05160  Hepatitis C
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05165  Human papillomavirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05200  Pathways in cancer
ggo05202  Transcriptional misregulation in cancer
ggo05203  Viral carcinogenesis
ggo05205  Proteoglycans in cancer
ggo05206  MicroRNAs in cancer
ggo05210  Colorectal cancer
ggo05211  Renal cell carcinoma
ggo05212  Pancreatic cancer
ggo05213  Endometrial cancer
ggo05214  Glioma
ggo05215  Prostate cancer
ggo05216  Thyroid cancer
ggo05217  Basal cell carcinoma
ggo05218  Melanoma
ggo05219  Bladder cancer
ggo05220  Chronic myeloid leukemia
ggo05222  Small cell lung cancer
ggo05223  Non-small cell lung cancer
ggo05224  Breast cancer
ggo05225  Hepatocellular carcinoma
ggo05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101126640 (CDKN1A)
   04630 JAK-STAT signaling pathway
    101126640 (CDKN1A)
   04066 HIF-1 signaling pathway
    101126640 (CDKN1A)
   04068 FoxO signaling pathway
    101126640 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    101126640 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101126640 (CDKN1A)
   04115 p53 signaling pathway
    101126640 (CDKN1A)
   04218 Cellular senescence
    101126640 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101126640 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    101126640 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101126640 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    101126640 (CDKN1A)
   05206 MicroRNAs in cancer
    101126640 (CDKN1A)
   05205 Proteoglycans in cancer
    101126640 (CDKN1A)
   05203 Viral carcinogenesis
    101126640 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101126640 (CDKN1A)
   05212 Pancreatic cancer
    101126640 (CDKN1A)
   05225 Hepatocellular carcinoma
    101126640 (CDKN1A)
   05226 Gastric cancer
    101126640 (CDKN1A)
   05214 Glioma
    101126640 (CDKN1A)
   05216 Thyroid cancer
    101126640 (CDKN1A)
   05220 Chronic myeloid leukemia
    101126640 (CDKN1A)
   05217 Basal cell carcinoma
    101126640 (CDKN1A)
   05218 Melanoma
    101126640 (CDKN1A)
   05211 Renal cell carcinoma
    101126640 (CDKN1A)
   05219 Bladder cancer
    101126640 (CDKN1A)
   05215 Prostate cancer
    101126640 (CDKN1A)
   05213 Endometrial cancer
    101126640 (CDKN1A)
   05224 Breast cancer
    101126640 (CDKN1A)
   05222 Small cell lung cancer
    101126640 (CDKN1A)
   05223 Non-small cell lung cancer
    101126640 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101126640 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101126640 (CDKN1A)
   05161 Hepatitis B
    101126640 (CDKN1A)
   05160 Hepatitis C
    101126640 (CDKN1A)
   05163 Human cytomegalovirus infection
    101126640 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101126640 (CDKN1A)
   05169 Epstein-Barr virus infection
    101126640 (CDKN1A)
   05165 Human papillomavirus infection
    101126640 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101126640 (CDKN1A)
   01522 Endocrine resistance
    101126640 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101126640
NCBI-ProteinID: XP_030868331
Ensembl: ENSGGOG00000014701
LinkDB
Position
6
AA seq 215 aa
MWGVFRRQTTHSSNPPLPGQQSCCNHRDFFCSGAMSEPAGDVRQNPCGSKACRRLFGPVD
SEQLSRDCDALMAGCIQEARERWNFDFVTETPLEGDFAWERVRGLGLPKLYLPTGPRRGR
DELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLVPRSGEQAEGSPGGPGDSQGRKRRQTS
MTGEDMCREGLCKGPGFSESMVQGLTCLVLVRHAP
NT seq 648 nt   +upstreamnt  +downstreamnt
atgtggggagtattcaggagacagacaactcactcgtcaaatcctccccttcctggccaa
caaagctgctgcaaccacagggatttcttctgttcaggcgccatgtcagaaccggctggg
gatgtccgtcagaacccatgtggcagcaaggcctgccgccgcctcttcggcccagtggac
agcgagcagctgagccgcgactgtgatgcgctaatggcgggctgcatccaggaggcccgc
gagcgatggaacttcgactttgtcaccgagacaccactggagggtgacttcgcctgggag
cgtgtgcggggccttggcctgcccaagctctaccttcccacggggccccggcgaggccgg
gatgagttgggaggaggcaggcggcctggcacctcacctgctctgctgcaggggacagca
gaggaagaccatgtggacctgtcactgtcttgtacccttgtgcctcgctcaggggagcag
gctgaagggtccccaggtggacctggagactctcagggtcgaaaacggcggcagaccagc
atgacaggtgaggacatgtgcagggaaggactttgtaagggaccaggattctcagaatcc
atggtccaagggctgacctgtctggtcctggtccggcatgctccttag

DBGET integrated database retrieval system