KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126661
Entry
101126661         CDS       T02442                                 

Gene name
GNRH1
Definition
(RefSeq) progonadoliberin-1
  KO
K05252  gonadotropin-releasing hormone
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04080  Neuroactive ligand-receptor interaction
ggo04912  GnRH signaling pathway
ggo04929  GnRH secretion
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101126661 (GNRH1)
 09150 Organismal Systems
  09152 Endocrine system
   04929 GnRH secretion
    101126661 (GNRH1)
   04912 GnRH signaling pathway
    101126661 (GNRH1)
SSDB
Motif
Pfam: GnRH
Other DBs
NCBI-GeneID: 101126661
NCBI-ProteinID: XP_018887546
Ensembl: ENSGGOG00000004479
UniProt: G3QPA2
LinkDB
Position
8
AA seq 96 aa
MCLRMKPIQKLLAGLILLTWCMEGCSSQHWSYGLRPGGKRDAENLIDSFQEIVKEVGQLA
ETQRFECTMHQPRSPLRDLKGALESLIEEETGQKKM
NT seq 291 nt   +upstreamnt  +downstreamnt
atgtgccttagaatgaagccaattcaaaaactcctagctggccttattctactgacttgg
tgcatggaaggctgctccagccagcactggtcctatggactgcgccctggaggaaagaga
gatgccgaaaatttgattgattctttccaagagatagtcaaagaggttggtcaactggca
gaaacccaacgcttcgaatgcaccatgcaccagccacgttctcccctccgagacctgaaa
ggagctctggaaagtctgattgaagaggaaactgggcagaagaagatgtaa

DBGET integrated database retrieval system