KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126764
Entry
101126764         CDS       T02442                                 

Gene name
PLA2G4C
Definition
(RefSeq) cytosolic phospholipase A2 gamma
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00564  Glycerophospholipid metabolism
ggo00565  Ether lipid metabolism
ggo00590  Arachidonic acid metabolism
ggo00591  Linoleic acid metabolism
ggo00592  alpha-Linolenic acid metabolism
ggo01100  Metabolic pathways
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04217  Necroptosis
ggo04270  Vascular smooth muscle contraction
ggo04370  VEGF signaling pathway
ggo04611  Platelet activation
ggo04664  Fc epsilon RI signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04724  Glutamatergic synapse
ggo04726  Serotonergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04921  Oxytocin signaling pathway
ggo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101126764 (PLA2G4C)
   00565 Ether lipid metabolism
    101126764 (PLA2G4C)
   00590 Arachidonic acid metabolism
    101126764 (PLA2G4C)
   00591 Linoleic acid metabolism
    101126764 (PLA2G4C)
   00592 alpha-Linolenic acid metabolism
    101126764 (PLA2G4C)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101126764 (PLA2G4C)
   04014 Ras signaling pathway
    101126764 (PLA2G4C)
   04370 VEGF signaling pathway
    101126764 (PLA2G4C)
   04072 Phospholipase D signaling pathway
    101126764 (PLA2G4C)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101126764 (PLA2G4C)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101126764 (PLA2G4C)
   04664 Fc epsilon RI signaling pathway
    101126764 (PLA2G4C)
   04666 Fc gamma R-mediated phagocytosis
    101126764 (PLA2G4C)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101126764 (PLA2G4C)
   04913 Ovarian steroidogenesis
    101126764 (PLA2G4C)
   04921 Oxytocin signaling pathway
    101126764 (PLA2G4C)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101126764 (PLA2G4C)
  09156 Nervous system
   04724 Glutamatergic synapse
    101126764 (PLA2G4C)
   04726 Serotonergic synapse
    101126764 (PLA2G4C)
   04730 Long-term depression
    101126764 (PLA2G4C)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101126764 (PLA2G4C)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101126764 (PLA2G4C)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101126764 (PLA2G4C)
SSDB
Motif
Pfam: PLA2_B
Other DBs
NCBI-GeneID: 101126764
NCBI-ProteinID: XP_030859780
Ensembl: ENSGGOG00000013321
LinkDB
Position
19
AA seq 677 aa
MRTRPRPRLRRTENFLTAVHHGKTEEKAAVERRRLHVLKALKKLRIEADEAPVVAVLGSG
GGLRAHIACLGVLSEMKEQGLLDAVTYLAGVSGSTWAISSLYTNDGDMEALEADLKHRFT
RQEWDVAKSLQKTIQAARSENYSLTDFWAYMVISKQTRELPESHLSNMKKPVEEGTLPYP
IFAAIDNDLQPSWQEARAPETWFEFTPHHAGFPALGAYVSITHFGSKFKKGRLVRTHPER
DLTFLRGLWGSALGNTEVIREYIFDQLRNLTLKGLWRRAVANAKSTGCLIFARLLRLQES
SQGEHPPPEDEGGEPEHTWLTEMLENWTRTSLEKQEQPHEDPERKGTLSNFMDFVKKTGI
CASKWEWGTTHNFLYKHGGIRDTIMSSRKHLHLVDAGLAINTPFPLVLSPTREVHLILSF
DFSAGDPFEVIEKGLGAGPGWEVGCGEADFAEELRTRAGKRAMGRCWLGSPETQINSPIA
PKAPAVCHIQRASDPKPSQTFPGPSSWQMTLPASASCLPIHTSLNCDSLAPHLCTSFPRG
ARLQPRTRVFLLIWVSWANMSHPVHPWAWRMPGCLSRSCMFMHVAASLCSLLVLPEYPTP
STWTSHIPHPVSGDIEAWSDTYDTFKLADTYTLDVVVLLLALAKKNVRENKKKILRELMN
VAGLYYPKDSARSCCLA
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgcgcacacgccccagacccaggctcaggaggactgagaattttctgaccgcagtgcac
catgggaagacagaagaaaaggcggccgtggagagacgaagacttcatgtgctaaaagct
ctgaagaagctaaggattgaggccgatgaggccccagttgttgctgtgctgggctcaggc
ggaggactgcgggctcacattgcctgccttggggtcctgagtgagatgaaagaacagggc
ctgttggatgctgtcacgtaccttgcaggggtctctggatccacttgggcaatatcttct
ctctacaccaacgatggtgacatggaagctctcgaggctgacctgaaacatcgatttacc
cgacaggagtgggacgtggctaagagcctacagaaaaccatccaagcagcgaggtctgag
aattactctctgaccgacttctgggcctacatggttatctctaagcaaaccagagaactg
ccggagtctcatttatccaatatgaagaagcccgtggaggaagggacactaccctacccg
atatttgcagccattgacaatgacctgcaaccttcctggcaggaggcaagagcaccagag
acctggttcgagttcacccctcaccacgctggcttccctgcactgggggcctatgtttcc
ataacccacttcggaagcaaattcaagaagggaagactggtcagaactcaccctgagaga
gacctgactttcctgagaggtttatggggaagtgctcttggtaacactgaagtcattagg
gaatacatttttgaccagttaaggaatctgaccctgaaaggtttatggagaagggctgtt
gctaatgctaaaagcactggatgccttatttttgcccgattactgaggctgcaagaaagt
tcgcaaggggaacatcctcccccagaagatgaaggcggtgagcctgaacacacctggctg
actgagatgctcgagaattggaccaggacctccctggaaaagcaggagcagccccatgag
gaccctgaaaggaaaggcacactcagtaactttatggattttgtgaagaaaacaggcatt
tgcgcttcgaagtgggaatgggggaccactcacaacttcctgtacaaacacggtggcatc
cgggacacgataatgagcagccggaagcacctccacctggtggatgctggtttagccatc
aacactcccttcccactcgtgctgtccccgacgcgggaggttcacctcatcctctccttc
gacttcagtgccggagatcctttcgaggtaatcgagaagggccttggggccggtcctggg
tgggaggtgggctgcggcgaagctgactttgcggaggaactgaggacacgggctgggaag
cgggcaatggggaggtgctggctgggaagtccagagacccaaatcaactcacccatcgct
cccaaagcacccgcagtctgccacatccaacgagcttctgatccaaagccatcccagacc
ttcccgggcccctcttcctggcagatgactctccccgcttctgcatcctgcctgcccatt
cataccagtttgaactgcgacagcctagctcctcacctgtgcacctccttccccaggggt
gcacgtctccagccccgaacgcgtgtcttcctgctcatctgggtttcctgggcaaatatg
agtcatcctgtccacccctgggcctggaggatgccaggctgcctctctcggtcttgcatg
tttatgcatgttgctgcctctctctgcagccttcttgtcctacctgaatatccaacccct
tccacctggacatcccacattcctcatccagtctcaggtgatattgaggcatggagtgac
acatacgacacattcaagctcgctgacacctacactctagatgtggtggtgctactcttg
gcattagccaagaagaatgtcagggaaaacaagaagaagatccttagagagttgatgaac
gtggccgggctctactacccgaaggatagtgcccgaagttgctgcttggcatag

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101137812
Entry
101137812         CDS       T02442                                 

Gene name
PLA2G4E
Definition
(RefSeq) cytosolic phospholipase A2 epsilon
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00564  Glycerophospholipid metabolism
ggo00565  Ether lipid metabolism
ggo00590  Arachidonic acid metabolism
ggo00591  Linoleic acid metabolism
ggo00592  alpha-Linolenic acid metabolism
ggo01100  Metabolic pathways
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04217  Necroptosis
ggo04270  Vascular smooth muscle contraction
ggo04370  VEGF signaling pathway
ggo04611  Platelet activation
ggo04664  Fc epsilon RI signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04724  Glutamatergic synapse
ggo04726  Serotonergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04921  Oxytocin signaling pathway
ggo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101137812 (PLA2G4E)
   00565 Ether lipid metabolism
    101137812 (PLA2G4E)
   00590 Arachidonic acid metabolism
    101137812 (PLA2G4E)
   00591 Linoleic acid metabolism
    101137812 (PLA2G4E)
   00592 alpha-Linolenic acid metabolism
    101137812 (PLA2G4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101137812 (PLA2G4E)
   04014 Ras signaling pathway
    101137812 (PLA2G4E)
   04370 VEGF signaling pathway
    101137812 (PLA2G4E)
   04072 Phospholipase D signaling pathway
    101137812 (PLA2G4E)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101137812 (PLA2G4E)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101137812 (PLA2G4E)
   04664 Fc epsilon RI signaling pathway
    101137812 (PLA2G4E)
   04666 Fc gamma R-mediated phagocytosis
    101137812 (PLA2G4E)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101137812 (PLA2G4E)
   04913 Ovarian steroidogenesis
    101137812 (PLA2G4E)
   04921 Oxytocin signaling pathway
    101137812 (PLA2G4E)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101137812 (PLA2G4E)
  09156 Nervous system
   04724 Glutamatergic synapse
    101137812 (PLA2G4E)
   04726 Serotonergic synapse
    101137812 (PLA2G4E)
   04730 Long-term depression
    101137812 (PLA2G4E)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101137812 (PLA2G4E)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101137812 (PLA2G4E)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101137812 (PLA2G4E)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 101137812
NCBI-ProteinID: XP_004056088
Ensembl: ENSGGOG00000011824
UniProt: G3R844
LinkDB
Position
15
AA seq 868 aa
MRLQASEGCPGLGTNVFVPQSPQRDEEGSRSGRSFSEFEDTQDLDTRGLPPFCPMAPWGS
EEGLSPCHLLTVRVIRMKNVRQADMLSQTDCFVSLWLPTASQKKLRTRTISNCPNPEWNE
SFNFQIQSRVKNVLELSVCDEDTVTPDDHLLTVLYDLTKLCFRKKTHVKFPLNPQGMEEL
EVEFLLEESPSPPETLVTNGVLVSRQVSCLEVHAQSRRRRKREKMKDLLVMVNESFENTQ
RVQPCLEPCCPTSACFQTAACFHYPKYFQSQVHVEVPKSHWSCGLCCCSRKNGPISQPLD
CLSDGQVMTLPVGESYELHMKSTPCPETLDVRLGFSLCPAELEFLQKRKVVVAKALKQVL
QLEEDLQEDEVPLIAIMATGGGTRSMTSMYGHLLGLQKLNLLDCASYITGLSGATWTMAT
LYRDPDWSSKNLEPAIFEARRHVVKDKLPSLFPDQLRKFQEELRQRSQEGYRVTFTDFWG
LLIETCLGDERNECKLSDQRAALSCGQNPLPIYLTINVKDDVSNQDFREWFEFSPYEVGL
QKYGAFIPSELFGSEFFMGRLVKRIPESRICYMLGLWSSIFSLNLLDAWNLSHTSEEFFH
RWTREKVQDIEDEPILPEIPKCDANILETTVVIPGSWLSNSFREILTHRSFVSEFHNFLS
GLQLHTNYLQNGQFSRWKDTVLDGFPNQLTESANHLCLLDTAFFVNSSYPPLLRPERKAD
LIIHLNYCAGSQTKPLKQTCEYCTVQNIPFPKYELPDENENLKECYLMENPQEPDAPIVT
FFPLINDTFRKYKAPGVERSPEELEQGQVDIYGPKTPYATKELTYTEATFDKLVKLSEYN
ILNNKDTLLQALRLAVEKKKRLKGQCPS
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgcgtctccaggcctcggaaggctgtcctggcctgggaactaatgtgtttgtcccacag
agcccacagagggatgaagaaggcagcaggtcaggaagaagtttcagtgagttcgaggat
acacaggacctggacactcgtggtctcccacctttctgtcctatggctccttggggctct
gaggaggggctgtctccatgccacctgttgacagtgagggtcatccggatgaaaaatgtc
cggcaggctgacatgctgagccagacagactgttttgtgagcctctggctgcccaccgcc
tctcagaagaagctgaggacaaggaccatctccaactgcccaaatccagagtggaatgaa
agcttcaacttccagatccagagccgagtgaagaacgtgctagagttgagtgtctgtgat
gaagacacagtgacacctgatgaccatctcctgacagttctctatgacctcaccaagctc
tgtttccgaaagaaaacccacgtgaagtttccactcaacccgcagggcatggaagagctg
gaggtggagttcctgctggaggagagtccctctccacctgagaccctcgtcaccaatggc
gtgctggtgtctcgacaagtctcctgcctggaggttcatgcacaatccaggaggcggagg
aagagggagaaaatgaaggacctcctggtgatggtgaatgaatcctttgagaacacccag
cgtgtccagccctgcttggaaccctgctgcccaacctctgcctgcttccaaaccgctgcc
tgcttccactaccccaagtacttccagtcccaggtgcacgtggaagtgcccaagagtcac
tggagctgtgggctttgctgctgctctcgcaagaacggccccatcagccagcccctcgac
tgcctttccgatggtcaggtgatgaccctgcctgtgggtgagagttatgaattacacatg
aagtctacaccctgccctgagacactggacgtgcggctgggcttcagcctgtgcccagca
gagctggagtttctgcagaagcggaaggtcgtggtggccaaggccctgaagcaggtgctg
cagctggaggaagacctgcaggaggatgaggtgccgctgatagccatcatggccactggg
ggtggaacaagatccatgacctccatgtatggccacctgctggggctgcagaagctgaac
ctcctggactgtgccagctacatcactggtctatcaggggccacctggaccatggctacc
ttgtaccgtgaccctgactggtcctccaaaaacttggagcctgctatctttgaggctcgg
agacacgtggtaaaggacaagctaccctccctgttcccagaccagctccgcaaattccag
gaggagctccggcagcgcagccaggaaggctacagggtcacctttacagacttctggggc
ctgctgatagagacctgcctgggggacgagagaaatgaatgcaaactgtcagatcagcgt
gctgctttaagctgcggccagaaccccctgcccatctacctcaccatcaatgtcaaggat
gatgtaagcaaccaggacttcagagagtggttcgagttctccccctacgaggtgggcctg
cagaagtatggggccttcatcccctccgagctcttcggctccgagttcttcatggggcgg
ctggtgaagaggatcccggagtctcgaatctgctacatgctaggcctgtggagcagcatc
ttctccctgaatctgctggatgcctggaatctgtcacacacctcggaggagtttttccac
aggtggacaagggagaaagtgcaggacatcgaagacgagccaatcctgcctgaaatcccc
aaatgtgatgctaacatcctggagaccacggtagtgatcccagggtcatggctgtccaat
tctttccgagaaatccttacccatcgttccttcgtatctgagtttcacaacttcctgtct
gggctgcagctgcacaccaactacctccagaatggccagttctctaggtggaaagacaca
gtgctggatggtttcccaaaccagctgaccgagtccgcgaaccacctgtgcctgctggac
actgcgttctttgtcaactccagctacccgcccctcctcaggccagagcgaaaagccgac
ctcatcatccacctcaactactgtgctgggtcccagacaaagcccctgaaacaaacttgt
gagtactgcactgtgcagaacatccccttccccaaatacgagctgccagatgagaatgaa
aatctcaaggaatgctacctgatggagaacccccaggaacccgatgcccccatcgtgact
ttcttcccactcatcaatgacactttccgaaaatacaaggcaccaggtgtagagcgaagc
cctgaggagctggagcagggccaggtggacatttatggtcccaaaactccctatgccacc
aaggagctgacatacacagaggccacctttgacaagctggtgaaactctcagagtataac
atcctgaataataaggacactctcctccaggctctgcggctcgcagtggagaagaagaag
cgcctgaagggccagtgtccctcctag

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101138793
Entry
101138793         CDS       T02442                                 

Gene name
PLA2G4F
Definition
(RefSeq) cytosolic phospholipase A2 zeta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00564  Glycerophospholipid metabolism
ggo00565  Ether lipid metabolism
ggo00590  Arachidonic acid metabolism
ggo00591  Linoleic acid metabolism
ggo00592  alpha-Linolenic acid metabolism
ggo01100  Metabolic pathways
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04217  Necroptosis
ggo04270  Vascular smooth muscle contraction
ggo04370  VEGF signaling pathway
ggo04611  Platelet activation
ggo04664  Fc epsilon RI signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04724  Glutamatergic synapse
ggo04726  Serotonergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04921  Oxytocin signaling pathway
ggo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101138793 (PLA2G4F)
   00565 Ether lipid metabolism
    101138793 (PLA2G4F)
   00590 Arachidonic acid metabolism
    101138793 (PLA2G4F)
   00591 Linoleic acid metabolism
    101138793 (PLA2G4F)
   00592 alpha-Linolenic acid metabolism
    101138793 (PLA2G4F)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101138793 (PLA2G4F)
   04014 Ras signaling pathway
    101138793 (PLA2G4F)
   04370 VEGF signaling pathway
    101138793 (PLA2G4F)
   04072 Phospholipase D signaling pathway
    101138793 (PLA2G4F)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101138793 (PLA2G4F)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101138793 (PLA2G4F)
   04664 Fc epsilon RI signaling pathway
    101138793 (PLA2G4F)
   04666 Fc gamma R-mediated phagocytosis
    101138793 (PLA2G4F)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101138793 (PLA2G4F)
   04913 Ovarian steroidogenesis
    101138793 (PLA2G4F)
   04921 Oxytocin signaling pathway
    101138793 (PLA2G4F)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101138793 (PLA2G4F)
  09156 Nervous system
   04724 Glutamatergic synapse
    101138793 (PLA2G4F)
   04726 Serotonergic synapse
    101138793 (PLA2G4F)
   04730 Long-term depression
    101138793 (PLA2G4F)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101138793 (PLA2G4F)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101138793 (PLA2G4F)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101138793 (PLA2G4F)
SSDB
Motif
Pfam: PLA2_B cPLA2_C2 C2
Other DBs
NCBI-GeneID: 101138793
NCBI-ProteinID: XP_004056091
Ensembl: ENSGGOG00000000369
UniProt: G3S105
LinkDB
Position
15
AA seq 849 aa
MLWALWPRWLADKMLPLLGAVLLQKREKRGPLWRHWRRETYPYYDLQVKVLRATNIRGAD
LLSKADCYVQLWLPTASPSPAQTRIVANCSDPEWNETFHYQIHGAVKNVLELTLYDKDIL
GSDQLSLLLFDLRSLKCGQPHKHTFPLNHQDSQELQVEFVLEKSQVPASEVITNGVLVAH
PCLRIQGTLRGDGTAPREEYGSRQLQLAVPGAYEKPQLLPLQPHTEPGLPPTFIFHVNPV
LSSRLHVELMELLAAVQSGPSVELEAQTSKLGEGGILLSSLPLGQEEQCSVALGEGQEVA
LSMKVEMSSGDLDLRLGFDLCDGEQEFLDRRKQVVSKALQQVLGLSEAPDSGQVPVVAVL
GSGGGTRAMSSLYGSLAGLQELGLLDTVTYLSGVSGSTWCISTLYRDPAWSQVALQGPIE
RAQVHVCSSKMGALSTERLQYYTQELGVRERSGHSVSLIDLWGLLVEYFLYQEENPAKLS
DQQEAVRQGQNPYPIYTSVNVRTNLSGEDFAEWCEFTPYEVGFPKYGAYVPTELFGSELF
MGRLLQLQPEPRICYLQGMWGSAFATSLDEIFLKTAGSGLSFLEWYRGSVNITDDCQKPQ
LHNPSRLRTRLLTPQGPFSQAVLDIFTSRFTSAQSFNFTRGLCLHKDYVAGREFVAWKDT
HPDAFPNQLTPMRDCLYLVDGGFAINSPFPLALLPQRAVDLILSFDYSLEAPFEVLKMTE
KYCLDRGIPFPSIEVGPEDMEEARECYLFAKAEDPRSPIVLHFPLVNRTFRTHLAPGVER
QTAEEKAFGDFIINRPDTPYGMMNFTYEPQDFDRLVALSRYNVLNNVETLKCALQLALDR
HQARERAGG
NT seq 2550 nt   +upstreamnt  +downstreamnt
atgctttgggcactctggccaaggtggctggcagacaagatgctgcccctcctgggggca
gtgctgcttcagaagagagagaagaggggccctctgtggaggcactggcggcgggaaacc
tacccatactatgacctccaggtgaaggtgctgagggccacaaacatccggggcgcagac
ctgctgtccaaagctgactgctatgtgcaactgtggctgcccacggcgtccccaagccct
gcccagactaggatagtggccaactgcagtgaccccgagtggaatgagaccttccactac
cagatccatggtgctgtgaagaacgtcctggagctcaccctctatgacaaggacatcctg
ggcagcgaccagctctctctgctcctgtttgacctgagaagcctcaagtgtggccaacct
cacaaacacaccttcccactcaaccaccaggattcacaagagctgcaggtggaatttgtt
ctggagaagagccaggtgcctgcatctgaagtcatcaccaacggggttctggtggctcac
ccctgtctgagaatccagggcacgctccggggagatgggacagccccacgggaagagtac
ggctctaggcagctccagctggcagtgcctggggcctacgagaagccacagctcttgccc
ctgcagcctcacacagagccaggcctcccacccacctttatcttccacgtgaacccagtg
ctgagctccaggctacacgtggagctgatggagctgctggcagctgtgcagagtggcccc
agcgtggagctggaggctcagaccagcaagctgggcgaggggggcatcctgctctcctct
ctgcccctaggccaggaggaacagtgttctgtggccctcggggagggccaggaggtggct
ctgagcatgaaggtggaaatgagctccggggacctagacctacgccttggctttgacctc
tgtgacggggagcaggagtttctggacaggaggaagcaggtcgtgtccaaggccctgcag
caagtgctgggattgagtgaggctccggacagtggccaggtgcctgtagtggctgtgttg
ggttccgggggtggaacccgagccatgtcttctctgtacggcagcctggcagggttgcag
gagctcggccttctagacactgtgacctacctgagtggggtctctgggtctacctggtgc
atctccacactctacagggacccagcctggtcccaggtggccttgcagggccccattgag
cgtgcccaggttcacgtctgcagcagtaagatgggagctttgtccacggagcggctacag
tactacactcaggaactgggggtccgggagcgcagtggccacagcgtgtccctcatcgac
ctctggggcctccttgttgagtatttcctgtaccaggaggagaaccctgccaagctgtct
gaccaacaggaggcggtccgccagggtcagaacccttaccccatttacaccagcgtcaac
gtccgcaccaacttgagtggggaagattttgcagagtggtgcgagttcacgccctatgag
gttggcttccccaagtacggggcttatgttcccaccgagctcttcggctcagaactcttt
atgggacgattgctgcagctccagcctgaaccccggatctgttacctgcaaggtatgtgg
ggcagcgcctttgccaccagcctggatgagatcttcctaaagaccgccggctcgggcctc
agcttcctggagtggtacagaggcagtgtgaatatcacagacgactgccagaagcctcag
ctgcacaacccctcgaggctgcgaacgaggctcctcaccccgcaggggcccttctcccag
gctgtgctggacatattcacctcccgcttcacttccgcccagagctttaacttcacccgg
ggtctctgcttgcacaaggactatgtggctggcagggagttcgtggcctggaaagacaca
cacccggacgccttccccaaccagctcacccccatgcgggactgcctgtacctggtggac
ggaggctttgccatcaactctccgttcccactggctctgctgcctcagagagcagtggac
ctcattctgtcctttgactattccttggaagccccttttgaggtcttgaagatgacagag
aagtactgcctggaccgaggaatccccttccctagcatcgaggtgggccctgaggacatg
gaggaggcccgtgagtgctatctgtttgccaaggctgaggacccccgctcccccattgtg
ctgcacttccctcttgttaaccgtaccttccgcacacacctggccccaggtgtggagcga
caaacagctgaggagaaggcctttggggactttatcatcaacaggccagacaccccctat
ggcatgatgaacttcacctatgagccccaggactttgatcggctggtggccctcagtcga
tacaacgtcctgaacaatgtggagaccttgaagtgcgccctccagctggctctggaccgg
caccaggctcgggagagggcagggggctga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101147399
Entry
101147399         CDS       T02442                                 

Gene name
PLA2G4A
Definition
(RefSeq) cytosolic phospholipase A2
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00564  Glycerophospholipid metabolism
ggo00565  Ether lipid metabolism
ggo00590  Arachidonic acid metabolism
ggo00591  Linoleic acid metabolism
ggo00592  alpha-Linolenic acid metabolism
ggo01100  Metabolic pathways
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04217  Necroptosis
ggo04270  Vascular smooth muscle contraction
ggo04370  VEGF signaling pathway
ggo04611  Platelet activation
ggo04664  Fc epsilon RI signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04724  Glutamatergic synapse
ggo04726  Serotonergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04921  Oxytocin signaling pathway
ggo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101147399 (PLA2G4A)
   00565 Ether lipid metabolism
    101147399 (PLA2G4A)
   00590 Arachidonic acid metabolism
    101147399 (PLA2G4A)
   00591 Linoleic acid metabolism
    101147399 (PLA2G4A)
   00592 alpha-Linolenic acid metabolism
    101147399 (PLA2G4A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101147399 (PLA2G4A)
   04014 Ras signaling pathway
    101147399 (PLA2G4A)
   04370 VEGF signaling pathway
    101147399 (PLA2G4A)
   04072 Phospholipase D signaling pathway
    101147399 (PLA2G4A)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101147399 (PLA2G4A)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101147399 (PLA2G4A)
   04664 Fc epsilon RI signaling pathway
    101147399 (PLA2G4A)
   04666 Fc gamma R-mediated phagocytosis
    101147399 (PLA2G4A)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101147399 (PLA2G4A)
   04913 Ovarian steroidogenesis
    101147399 (PLA2G4A)
   04921 Oxytocin signaling pathway
    101147399 (PLA2G4A)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101147399 (PLA2G4A)
  09156 Nervous system
   04724 Glutamatergic synapse
    101147399 (PLA2G4A)
   04726 Serotonergic synapse
    101147399 (PLA2G4A)
   04730 Long-term depression
    101147399 (PLA2G4A)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101147399 (PLA2G4A)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101147399 (PLA2G4A)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101147399 (PLA2G4A)
SSDB
Motif
Pfam: PLA2_B C2
Other DBs
NCBI-GeneID: 101147399
NCBI-ProteinID: XP_004028114
Ensembl: ENSGGOG00000012337
UniProt: G3R9G5
LinkDB
Position
1
AA seq 749 aa
MSFIDPYQHIIVEHQYSHKFTVVVLRATKVTKGAFGDMLDTPDPYVELFISTTPDSRKRT
RHFNNDINPVWNETFEFILDPNQENVLEITLMDANYVMDETLGTATFTVSSMKVGEKKEV
PFIFNQVTEMVLEMSLEVCSCPDLRFSMALCDQEKTFRQQRKEHIRESMKKLLGPKNSEG
LHSARDVPVVAILGSGGGFRAMVGFSGVMKALYESGILDCATYIAGLSGSTWYMSTLYSH
PDFPEKGPEEINEELMKNVSHNPLLLLTPQKVKRYVESLWKKKSSGQPVTFTDIFGMLIG
ETLIHNRMNTTLSSLKEKVNTAQCPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMAPDLFGSKFFMGTIVKKYEENPLHFLMGVWGSAFSILFNRVLGVSGSQSRGSTMEEE
LENITTKHIVSNDSSDSDDESHEPKGTENEDAGSDYQSDNQASWIHRMIMALVSDSALFN
TREGRAGKVHNFMLGLNLNTSYPLSPLSDFATQDSFDDDELDAAVADPDEFERIYEPLDV
KSKKIHVVDSGLTFNLPYPLILRPQRGVDLIISFDFSARPSDSSPPFKELLLAEKWAKMN
KLPFPKIDPYVFDREGLKECYVFKPKNPDMEKDCPTIIHFVLANINFRKYKAPGVPRETE
EEKEIADFDIFDDPESPFSTFNFQYPNQAFKRLHDLMHFNTLNNIDVIKEAMVESIEYRR
QNPSRCSVSLSNVEARRFFNKEFLSKPKA
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcatttatagatccttaccagcacattatagtggagcaccagtattcccacaagttt
acggtagtggtattacgtgccaccaaagtgacaaagggggcctttggtgacatgcttgat
actccagatccctatgtggaactttttatctctacaacccctgacagcaggaagagaaca
agacatttcaataatgacataaaccctgtgtggaatgagacctttgaatttattttggat
cctaatcaggaaaatgttttggagattacgttaatggatgccaattatgtcatggatgaa
actctagggacagcaacatttactgtatcttctatgaaggtgggagagaagaaagaagtt
ccttttattttcaaccaagtcactgaaatggttctagaaatgtctcttgaagtttgctca
tgcccagacctacgatttagtatggctctgtgtgatcaggagaagactttcagacaacag
agaaaagaacacataagggagagcatgaagaaactcttgggtccaaagaatagtgaagga
ttgcattctgcacgtgatgtgcctgtggtagccatattgggttcaggtgggggtttccga
gccatggtgggattctctggtgtgatgaaggcattatacgaatcaggaattctggattgt
gctacctacattgctggtctttctggctccacctggtatatgtcaaccttgtattctcac
cctgattttccagagaaagggccagaggagattaatgaagaactaatgaaaaatgttagc
cacaatccccttttacttctcacaccacagaaagttaaaagatatgttgagtctttatgg
aagaagaaaagctctggacaacctgtcacctttactgatatctttgggatgttaatagga
gaaacactaattcataatagaatgaatactactctgagtagtttgaaggaaaaagttaat
actgcacaatgccctttacctcttttcacctgtcttcatgtcaaacctgacgtttcagag
ctgatgtttgcagattgggttgaatttagtccatacgaaattggcatggctaaatatggt
acttttatggctcctgacttatttggaagcaaattttttatgggaacaatcgttaagaag
tatgaagaaaaccccttgcatttcttaatgggtgtctggggcagtgccttttccatattg
ttcaacagagttttgggcgtttctggttcacaaagcagaggctccacaatggaggaagaa
ttagaaaacattaccacaaagcatattgtgagtaatgatagctcggacagtgatgatgaa
tcacacgaacccaaaggcactgaaaatgaagatgctggaagtgactatcaaagtgataat
caagcaagttggattcatcgtatgataatggccttggtgagtgattcagctttattcaat
accagagaaggacgtgctgggaaggtacacaacttcatgctgggcttgaatctcaataca
tcttatccactgtctcctttgagtgactttgccacacaggactcctttgatgatgatgaa
ctggatgcagctgtagcagatcctgatgaatttgagcgaatatatgagcctctggatgtc
aaaagtaaaaagattcatgtagtggacagtgggctcacatttaacctgccgtatcccttg
atactgagacctcagagaggggttgatctcataatctcctttgacttttctgcaaggcca
agtgactctagtcctccgttcaaggaacttctacttgcagaaaagtgggctaaaatgaac
aagctcccctttccaaagattgatccttatgtgtttgatcgggaagggctgaaggagtgc
tatgtctttaaacccaagaatcctgatatggagaaagattgcccaaccatcatccacttt
gttctggccaacatcaacttcagaaagtacaaggctccaggtgttccaagggaaactgag
gaagagaaagaaatcgctgactttgatatttttgatgacccagaatcaccattttcaacc
ttcaattttcaatatccaaatcaagcattcaaaagactacatgatcttatgcacttcaat
actctgaacaacatcgatgtgataaaagaagccatggttgaaagcattgaatatagaaga
cagaatccatctcgttgctctgtttcccttagtaatgttgaggcaagaagatttttcaac
aaggagtttctaagtaaacccaaagcatag

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 109025233
Entry
109025233         CDS       T02442                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00564  Glycerophospholipid metabolism
ggo00565  Ether lipid metabolism
ggo00590  Arachidonic acid metabolism
ggo00591  Linoleic acid metabolism
ggo00592  alpha-Linolenic acid metabolism
ggo01100  Metabolic pathways
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04217  Necroptosis
ggo04270  Vascular smooth muscle contraction
ggo04370  VEGF signaling pathway
ggo04611  Platelet activation
ggo04664  Fc epsilon RI signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04724  Glutamatergic synapse
ggo04726  Serotonergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04921  Oxytocin signaling pathway
ggo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    109025233 (PLA2G4D)
   00565 Ether lipid metabolism
    109025233 (PLA2G4D)
   00590 Arachidonic acid metabolism
    109025233 (PLA2G4D)
   00591 Linoleic acid metabolism
    109025233 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    109025233 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    109025233 (PLA2G4D)
   04014 Ras signaling pathway
    109025233 (PLA2G4D)
   04370 VEGF signaling pathway
    109025233 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    109025233 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    109025233 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109025233 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    109025233 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    109025233 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    109025233 (PLA2G4D)
   04913 Ovarian steroidogenesis
    109025233 (PLA2G4D)
   04921 Oxytocin signaling pathway
    109025233 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    109025233 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    109025233 (PLA2G4D)
   04726 Serotonergic synapse
    109025233 (PLA2G4D)
   04730 Long-term depression
    109025233 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109025233 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    109025233 (PLA2G4D)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     109025233 (PLA2G4D)
SSDB
Motif
Pfam: cPLA2_C2 PLA2_B C2
Other DBs
NCBI-GeneID: 109025233
NCBI-ProteinID: XP_030858200
LinkDB
Position
15
AA seq 818 aa
MESLSPGGPPGHPYQGEASTCWQLTVRVLEARNLRWADLLSEADPYVILQLSTAPGMKFK
TKTLTDTSHPVWNEAFHFLIQSQVKNVLELSIYDEDSVTEDDICFKVLYDVSEVLPGKLL
RKTFSQSPQGEEELDVEFLMEETSDRPENLITNKVLVARELSCLDVHLDSTGSTAVVADQ
DKLELELVLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSTSNGWNGDNSARYL
TVPLRPLNIGKEVTMDVPAPNAPGVRLQLKAEGCPEELAVHLGFNLCAEEQAFLSRRKQV
VAKALKQALQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGI
SGSTWTMAHLYGDAEWSQRDLEGPIRYAREHLTKSKLEVFSPERLASYRRELELRAEQGY
PTTFVDLWALVLESMLHGQVMDQKLSGQRAALERGQNPLPLYLSLNVKENNLETLDFKEW
VEFSPYEVGFLKYGAFVPPELFGSEFFMGRLMRRIPEPRICFLEAIWSNIFSLNLLDAWY
DLTSSGESWKQHIKDKTRSLEKEPLTTSGTSSRLEASWLQPGMALAQAFKGFLTGRPLHQ
RSPNFLQGLQLHQDYRSHKDFSTWADCQLDSMPSQLTPQEARLCLVDAGYFINTSCPSMF
RPGRRLDLILSFDYSLSAPFEALQQTELYCRARGLPFPRVEPSPLDQHQPRECHLFSDPA
CPEAPILLHFPLVNASFKDHSAPGVQRSPAELQGGQVDLTGATCPYTLSNMTYKEEDFER
LLRLSDYNVQTSQGAILQALRTALKHRTLEARPPRAQT
NT seq 2457 nt   +upstreamnt  +downstreamnt
atggagagcctgtcacctgggggaccacctggccacccttaccagggggaggcctctacc
tgctggcagctcaccgtgagggtcctggaggcgcggaacctgcgctgggctgacctgttg
agtgaggccgacccttacgtgatcctacagctgtcgaccgcacctggaatgaagtttaag
accaagacgctcaccgacaccagtcatcctgtgtggaatgaggccttccatttccttatc
caaagtcaggtcaagaatgttctggagcttagcatctatgatgaggactcagtcacggag
gatgatatctgcttcaaggttctctatgacgtctcagaagtcctccctggcaagctgctc
cggaaaaccttctcccagagtccccagggagaggaggagctggatgtggagttcctgatg
gaagaaacgtcagatcgcccagaaaacctcatcaccaacaaagtccttgtggctcgagag
ctgtcatgcctggatgtgcatctggacagcacagggagcaccgctgtggttgcagatcag
gacaagctggagctggagctggtgctgaaggggtcctatgaggacacacagacatccttc
ctgggcacagcctctgccttccgcttccactacatggcagccctagagacagagctgagc
gggcgcctgaggagctccacaagcaatggctggaatggggacaactcagctcggtacctc
actgtgcccctgaggcccttgaacattgggaaggaggtgactatggatgttcctgctcca
aatgccccaggagtgaggctgcagctgaaggcagagggctgccctgaggagctggccgtg
cacctgggcttcaatctctgtgcagaggagcaggccttcctgagcaggaggaagcaggtg
gtggccaaggccctgaagcaggccctgcagctggacagagacctgcaggaggatgaggta
cccgtcgtgggcatcatggccacaggaggaggtgcccgggccatgacctcgctctacggc
cacctattggccttgcagaagctgggcctcctagactgtgtgacctacttcagtggcatc
tctggctctacgtggacaatggcccacctgtacggggacgctgagtggtcgcagagggac
ctggagggacctatcagatacgcccgggagcacctgaccaagagcaagctggaggtcttt
tccccagagcgcctggcgagctaccgccgggagctggagctgcgggctgagcagggctac
cccacgacttttgtggacctgtgggcgctagtgctggagtccatgctgcacggccaggtg
atggatcagaagctgtcaggacagagagccgccctggaacggggtcagaaccctctgccc
ctctacttgagcctcaatgtcaaagagaacaatctggagacactggacttcaaggagtgg
gttgagttctccccctatgaggtcggtttcctgaagtacggggccttcgtccctcctgag
ctcttcggctccgagttcttcatgggacggctgatgaggaggatcccggagccccggatc
tgctttctggaagccatctggagcaacattttctccctgaacctgctggacgcctggtat
gacctcaccagttctggggagtcctggaaacagcacatcaaggacaagaccaggagctta
gagaaggagcccctgaccacctcggggacctcctcgcggctggaggcctcgtggctgcag
ccaggcatggcgctggcccaggcatttaaaggcttcctgaccggcaggcccctccaccag
cgcagccccaacttcctccagggcctccagctgcaccaggactaccgtagccacaaagac
ttctccacctgggcagactgccagcttgactccatgcccagccagctgaccccccaggag
gcccggctctgcctggtggacgccggctacttcatcaacactagctgtccctccatgttc
cggccaggccgcaggctggacctcatcctctccttcgactactccctatctgcgcccttc
gaggcgctgcagcagacggagctgtactgccgggcccgggggctgcccttcccccgggtg
gaacccagccctctggaccagcaccagccaagggagtgccacctcttctcagaccccgcc
tgccccgaggccccaatcctgctgcacttcccgctggtcaatgcctccttcaaggaccac
tcagcccccggtgtccagcgcagccccgcagagctccagggtggccaagtggatctcacc
ggggccacctgcccctacaccctgtccaacatgacctacaaggaggaagacttcgagcgc
ctgctgcggctcagtgactacaacgtgcagaccagccagggtgccatcctgcaggccctg
aggaccgcgctgaagcaccggaccctagaggcgaggcctccaagggcacagacctga

DBGET integrated database retrieval system