KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126857
Entry
101126857         CDS       T02442                                 

Gene name
GNRHR
Definition
(RefSeq) gonadotropin-releasing hormone receptor isoform X1
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04080  Neuroactive ligand-receptor interaction
ggo04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101126857 (GNRHR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101126857 (GNRHR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ggo04030]
    101126857 (GNRHR)
G protein-coupled receptors [BR:ggo04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    101126857 (GNRHR)
SSDB
Motif
Pfam: 7tm_1 DUF3307
Other DBs
NCBI-GeneID: 101126857
NCBI-ProteinID: XP_004038783
Ensembl: ENSGGOG00000016163
UniProt: G3RJ87
LinkDB
Position
4
AA seq 328 aa
MANSASPEQNQNHCSAINNSIPLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKL
QKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYL
KLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKLGQSMVGLAWILSSVFAGPQLYIFRM
IHLADSSGQTKVFSQCVTHCSFSQWWHQAFYNFFTFSCLFIIPLFIMLICNAKIIFTLTR
VLHQDPHELQLNQSKNNIPKARLKTLKMTVAFATSFTVCWTPYYVLGIWYWFDPEMLNRV
SDPVNHFFFLFAFLNPCFDPLIYGYFSL
NT seq 987 nt   +upstreamnt  +downstreamnt
atggcaaacagtgcctctcctgaacagaatcaaaatcactgttcagccatcaacaacagc
atcccactgatgcagggcaacctccccactctgaccttgtctggaaagatccgagtgacg
gttactttcttcctttttctgctctctgcaacctttaatgcttctttcttgttgaaactt
cagaagtggacacagaagaaagagaaagggaaaaagctctcaagaatgaaactgctctta
aaacatctgaccttagccaacctgttggagactctgattgtcatgccactggatgggatg
tggaacattacagtccaatggtatgctggagagttactctgcaaagttctcagttaccta
aagcttttctccatgtatgccccagccttcatgatggtggtgatcagcctggaccgctcc
ctggctatcacgaggcccctagctttgaaaagcaacagcaaactcggacagtccatggtt
ggcctggcctggatcctcagtagtgtctttgcgggaccacagttatacatcttcaggatg
attcatctagcagacagctccggacagacaaaagttttctctcaatgtgtaacacactgc
agtttttcacaatggtggcatcaagcattttataactttttcaccttcagctgcctcttc
atcatccctcttttcatcatgctgatctgcaatgcaaaaatcatcttcaccctgacacgg
gtccttcatcaggacccccacgaactacaactgaatcagtccaagaacaatataccaaaa
gcacggctgaagactctaaagatgacggttgcatttgccacttcatttactgtctgctgg
actccctactatgtcctaggaatttggtattggtttgatcctgaaatgttaaacagggtg
tcagacccagtaaatcacttcttctttctctttgcctttttaaacccatgctttgatcca
cttatctatggatatttttctctgtga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101137503
Entry
101137503         CDS       T02442                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: putative gonadotropin-releasing hormone II receptor
  KO
K04280  gonadotropin-releasing hormone receptor
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04080  Neuroactive ligand-receptor interaction
ggo04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101137503
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101137503
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ggo04030]
    101137503
G protein-coupled receptors [BR:ggo04030]
 Rhodopsin family
  Peptide
   Gonadotropin-releasing hormone (GnRH)
    101137503
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 101137503
NCBI-ProteinID: XP_004026536
LinkDB
Position
1
AA seq 379 aa
MSAGNGTPWGXAAGEEVWAGSGVEVEGSELPTFSAAAKVRVGVTIVLFVSSAGGNLAVLW
SVTRRQPSQLRPSPVRILFAHLAAAVLLVTFVVMPLDATWNITVQWLAVDIACRTLMFLK
LMATYSAAFLPVVIGLDRQAAVLNPLGSRSGVRKLLGAAWGLSFLLALPQLFLFHTVHUA
GPVPFTQCVTKGSFKAQXQETTYNLFTFCCLFLLPLTAMAICYSRIVLSVSSPQTRKGSH
APAGEFALPHSFDNCPRVRLRALRLALLILLTFILCWTPYYLLGMWYGFSPTMLTEVPPN
LSHILFLLGLLNAPLDPLLYGAFTLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQ
KTVTSRRAGEIKGISITSI
NT seq 1140 nt   +upstreamnt  +downstreamnt
atgtctgcaggcaacggcaccccttggggtncagcagcgggggaggaggtctgggctgga
tcaggagtggaggtggagggctcagagctgcccaccttctcggcagcagccaaggtccga
gtgggagtgaccattgtgctgtttgtttcttcggctggagggaacctggcagtcctgtgg
tcagtgacacggcggcaacccagccagctccgcccctctccggtcaggatactcttcgcc
catttagcagccgccgtcctactagtcacttttgtggttatgcccctagatgccacctgg
aatatcactgttcaatggctggctgtggacatcgcatgtcggacactcatgttcctgaaa
ctaatggccacgtattctgcagctttcctgcctgtggtcattggattggaccgccaggca
gcagtactcaacccgcttggatcccgttcaggtgtaaggaaacttctgggggcagcctgg
ggacttagtttcctgcttgccttgccccagctgttcctgttccacaccgtccactgagct
ggcccagtccctttcactcagtgtgtcaccaaaggcagcttcaaggctcaatgacaagag
accacctataacctcttcaccttctgctgcctctttctgctgccactgactgccatggcc
atctgctatagccgcattgtcctcagtgtgtccagcccccagacaaggaaggggagccat
gcccctgctggtgaatttgccctcccccattcctttgacaattgtccccgtgttcgtctc
cgggccctgagactggccctgcttatcttgctgaccttcatcctctgctggacaccttat
tacctactgggtatgtggtacgggttctcccccaccatgctaactgaagtccctcccaac
ctgagccacatccttttcctcttgggcctcctcaatgctcctttggatcctctcctctat
ggggccttcacccttggctgccgaagagggcaccaagaacttagtatagactcttctaaa
gaagggtctgggagaatgctccaagaggagattcatgcctttagacagctggaagtacaa
aaaactgtgacatcaagaagggcaggagaaataaaaggcatttctataacatctatctga

DBGET integrated database retrieval system