KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101126932Help
Entry
101126932         CDS       T02442                                 

Gene name
HBB
Definition
(RefSeq) hemoglobin subunit beta
  KO
K13823  hemoglobin subunit beta
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo05143  African trypanosomiasis
ggo05144  Malaria
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09160 Human Diseases
  09174 Infectious diseases: Parasitic
   05144 Malaria
    101126932 (HBB)
   05143 African trypanosomiasis
    101126932 (HBB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101126932 (HBB)
Membrane trafficking [BR:ggo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    101126932 (HBB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin BCA_ABC_TP_C
Motif
Other DBs
NCBI-GeneID: 101126932
NCBI-ProteinID: XP_018891709
Ensembl: ENSGGOG00000021936
UniProt: P02024
LinkDB All DBs
Position
11
AA seq 147 aa AA seqDB search
MVHLTPEEKSAVTALWGKVNVDEVGGEALGRLLVVYPWTQRFFESFGDLSTPDAVMGNPK
VKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFKLLGNVLVCVLAHHFG
KEFTPPVQAAYQKVVAGVANALAHKYH
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggtgcacctgactcctgaggagaagtctgccgttactgccctgtggggcaaggtgaac
gtggatgaagttggtggtgaggccctgggcaggctgctggtggtctacccttggacccag
aggttctttgagtcctttggggatctgtccactcctgatgctgttatgggcaaccctaag
gtgaaggctcatggcaagaaagtgctcggtgcctttagtgatggcctggctcacctggac
aacctcaagggcacctttgccacactgagtgagctgcactgtgacaagctgcacgtggat
cctgagaacttcaagctcctgggcaatgtgctggtctgtgtgctggcccatcactttggc
aaagaattcaccccaccagtgcaggctgcctatcagaaagtggtggctggtgtggctaat
gccctggcccacaagtatcactaa

DBGET integrated database retrieval system