KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101127133Help
Entry
101127133         CDS       T02442                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo03030  DNA replication
ggo03410  Base excision repair
ggo03420  Nucleotide excision repair
ggo03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101127133 (LIG1)
   03410 Base excision repair
    101127133 (LIG1)
   03420 Nucleotide excision repair
    101127133 (LIG1)
   03430 Mismatch repair
    101127133 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ggo03032]
    101127133 (LIG1)
   03400 DNA repair and recombination proteins [BR:ggo03400]
    101127133 (LIG1)
Enzymes [BR:ggo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     101127133 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     101127133 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     101127133 (LIG1)
DNA replication proteins [BR:ggo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    101127133 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     101127133 (LIG1)
DNA repair and recombination proteins [BR:ggo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     101127133 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     101127133 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     101127133 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C DUF1685
Motif
Other DBs
NCBI-GeneID: 101127133
NCBI-ProteinID: XP_018871609
Ensembl: ENSGGOG00000015042
LinkDB All DBs
Position
19
AA seq 809 aa AA seqDB search
MDSSPSGIPKRRTARKQLPKRTIQEVLEEQSEDEDREAKRKKEEEEAETPKESLTEAEVA
TEKEGEDGDQPTTPPKPLKTSKAETPTEGGSEPEVATKQELQEEEEPTKPPPRAPRTLSS
FFTPRKPAVKKEVKEEEPGAPGKEGAAEGPLDPSGYNPAKNNYHPVEDACWKPGQKVPYL
AVARTFEKIEEVSARLRMVETLSNLLRSVVALSPPDLLPVLYLSLNHLGPPQQGLELGVG
DGVLLKAVAQATGRQLESVRAEAAEKGDVGLVAENSRSTQRLMLPPPPLTASGVFSKFRD
IARLTGSASTAKKIDIIKGLFVACRHSEARFIARSLSGRLRLGLAEQSVLAALSQAVSLT
PPGQEFPPAVVDAGKGKAAEARKTWLEEQGMILKQTFCEVPDLDRIIPVLLEHGLERLPE
HCKLSPGIPLKPMLAHPTRGVSEVLKRFEEAAFTCEYKYDGQRAQIHALEGGEVKIFSRN
QEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASE
IQVQVCLYAFDLIYLNGESLVREPLSRRRQLLRENFVETEGEFVFATSLDTKDVEQIAEF
LEQSVKDSCEGLMVKTLDVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGRGK
RAGRYGGFLLASYDEDSEELQAICKLGTGFSDEELEEHHQSLKALVLPSPRPYVRIDGAV
IPDHWLDPSAVWEVKCADLSLSPIYPAARGLVDSDKGISLRFPRFIRVREDKQPEQATTS
AQVACLYRKQSQIQNQQGEDSGSDPEDTY
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atggacagttccccatcagggattccgaagcgtcgcacagctcggaagcagctcccgaaa
cggaccattcaggaagtcctggaagagcagagtgaggacgaggacagagaagccaagagg
aagaaggaggaggaagaagcggagaccccgaaagaaagcctcacagaggctgaagtggca
acagagaaggaaggagaagacggggaccagcccaccacgcctcccaagcccctaaagacc
tccaaagcagagaccccgacggaaggcggttcagagcctgaggtggccacgaagcaggaa
ctgcaggaggaggaagagccgaccaagcctccccccagagctcccaggacgctcagcagc
ttcttcaccccccggaagccagcagtcaaaaaagaagtgaaggaagaggagccaggggct
ccaggaaaggagggagctgctgagggacccctggatccatccggttacaatcctgccaag
aacaactatcatcccgtggaagatgcctgctggaaaccgggccagaaggttccttacctg
gccgtggcccggacgtttgagaagatcgaggaggtgtctgctcggctccggatggtggag
acgctgagcaacttgctgcgctccgtggtggccctgtcgcctccagacctccttcctgtc
ctctacctcagcctcaaccaccttgggccgccccagcagggcctggagcttggcgtgggt
gatggtgtccttctcaaggcagtggcccaggccacaggtcgccagctggagtctgtccgg
gctgaggcagccgagaaaggcgacgtggggctggtggccgagaacagccgcagcacccag
aggctcatgctgccaccacctccgctcactgcctccggggtcttcagcaagttccgcgac
atcgccaggctcactggcagtgcttccacagccaagaagatagacatcatcaaaggcctc
tttgtggcctgccgccactcagaagcccggttcatcgccaggtccctgagcggacggctg
cgccttgggctggcagagcagtcggtgctggctgccctctcccaggcagtgagcctcacg
cccccgggccaagaattcccaccagccgtggtggatgctgggaagggcaaggcagcagag
gccagaaagacgtggctggaggagcaaggcatgatcctgaagcagacgttctgcgaggtt
cctgacctggaccgaattatccccgtgctgctggagcacggcctggaacgtctcccggag
cactgcaagctgagcccagggattcccctgaaaccaatgttggcccatcccacgcggggt
gtcagcgaggtcctgaaacgctttgaggaggcagctttcacctgcgaatacaaatatgac
gggcagagggcacagatccacgccctggaaggcggggaggtgaagatcttcagcaggaat
caggaagacaacactgggaagtacccggacatcatcagccgcatccccaagattaaactc
ccatcagtcacatccttcatcctggacaccgaagccgtggcttgggaccgggaaaagaag
cagatccagccattccaagtgctcaccacccgcaaacgcaaggaggtggatgcatccgag
atccaggtgcaggtgtgtttgtacgctttcgacctcatctacctcaatggagagtccctg
gtacgtgagcccctttcccggcgccggcagctgctccgggagaactttgtggagacagag
ggcgagtttgtcttcgccacctccctggacaccaaggatgtcgagcagatcgccgagttc
ctggagcagtcggtgaaagactcctgcgagggactgatggtgaagaccctggatgttgat
gccacctacgagatcgccaagagatcgcacaactggctcaagctgaagaaggactacctt
gatggcgtgggtgacaccctggacctggtggtgatcggcgcctacctgggccgggggaag
cgggccggccggtacgggggcttcctgctggcctcctacgacgaggacagtgaggagctg
caggccatatgcaagcttggaactggcttcagcgacgaggagctggaggagcatcaccag
agcctcaaggccctggtgctgcccagcccacgcccttacgtgcggatagatggcgctgtg
attcccgaccactggctggaccccagcgccgtgtgggaggtgaagtgcgctgacctctcc
ctctcccccatctaccctgctgcgcggggcctggtggatagtgacaagggcatctccctt
cgcttccctcggtttattcgagtccgtgaagacaaacagccggagcaggccaccaccagt
gcccaggtggcctgtttgtaccggaagcaaagtcagattcagaaccaacaaggcgaggac
tcaggctctgaccctgaagatacctactaa

DBGET integrated database retrieval system