KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101127142Help
Entry
101127142         CDS       T02442                                 

Gene name
SOD1
Definition
(RefSeq) superoxide dismutase 1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04146  Peroxisome
ggo04213  Longevity regulating pathway - multiple species
ggo05014  Amyotrophic lateral sclerosis (ALS)
ggo05016  Huntington's disease
ggo05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101127142 (SOD1)
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    101127142 (SOD1)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    101127142 (SOD1)
   05016 Huntington's disease
    101127142 (SOD1)
   05020 Prion diseases
    101127142 (SOD1)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     101127142 (SOD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 101127142
NCBI-ProteinID: XP_004062735
Ensembl: ENSGGOG00000015554
UniProt: A0A2I2Z7B3
LinkDB All DBs
Position
21
AA seq 154 aa AA seqDB search
MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTS
AGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVFIEDSVISLSGDHCIIGRTLVV
HEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaaggccgtgtgcgtgctgaagggcgacggcccagtgcagggcatcatcaat
ttcgagcagaaggaaagtaatggaccagtgaaggtgtggggaagcattaaaggactgact
gaaggcctgcacggattccatgttcatgagtttggagataatacagcaggctgtaccagt
gcaggtcctcactttaatcctctatccagaaaacacggtgggccaaaggatgaagagagg
catgttggggacttgggcaatgtgactgctgacaaagatggtgtggccgatgtgtttatt
gaagattctgtgatctcactctcaggagaccattgcatcattggccgcacactggtggtc
catgaaaaagcagatgacttgggcaaaggtggaaatgaagaaagtacaaagacaggaaac
gctggaagtcgtttggcttgtggtgtaattgggatcgcccaataa

DBGET integrated database retrieval system