KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101127404Help
Entry
101127404         CDS       T02442                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00052  Galactose metabolism
ggo00500  Starch and sucrose metabolism
ggo01100  Metabolic pathways
ggo04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101127404 (MGAM)
   00500 Starch and sucrose metabolism
    101127404 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101127404 (MGAM)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101127404 (MGAM)
    3.2.1.20  alpha-glucosidase
     101127404 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 101127404
NCBI-ProteinID: XP_018886043
Ensembl: ENSGGOG00000003832
LinkDB All DBs
Position
7
AA seq 815 aa AA seqDB search
MNFLVISTFLQVAIITDIDLLLGEAYTVEWGIKIRDEEKIDCYPDENGASAENCTARGCI
WEASNSSGVPFCYFVNDLYSVSDVQYNSHGATADISLKSSVYANAFPSTPVNPLRLDVTY
HKNEMLQFKIYDPNNNRYEVPVPLNIPSVPSSTPEGQLYDVLIKKNPFGIEIRRKSTGTI
IWDSQLLGFTFSDMFIRISTRLPSKYLYGFGETEHRSYRRDLEWHTWGMFSRDQPPGYKK
NSYGVHPYYMGLEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGVLDFYVFLGPTPEL
VTQQYTELIGRPVMVPYWSLGFQLCRYGYQNDSEIASLYDEMVAAQIPYDVQYSDIDYME
RQLDFTLSPKFAGFPALINRMKADGMRVILILDPAISGNETQPYPAFTRGVEDDVFIKYP
NDGDIVWGKVWPDFPDVVVNGSLDWDSQVELYRAYVAFPDFFRNSTAKWWKREIEELYNN
PQDPERSLKFDGMWIDMNEPSSFVNGAVSPGCRDASLNHPPYMPHLESRDRGLSSKTLCM
ESQQILPDGSPVQHYNVHNLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWAGHWL
GDNTAAWDQLKKSIIGMMEFSLFGISYTGADICGFFEDAEYEMCVRWMQLGAFYPFSRNH
NTIGTRRQDPVSWDAAFVNISRNVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSD
QVTWDIDSQFLLGPAFLVSPVLERVSMEASDEGRIPAVRLGEKDEEKGPELVLFVGFPGS
YLHFLTKGISGMPTSLKILRDVTHCLLTSSTARRM
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccttgtgatttccacattcctacaggttgccattatcacagatatcgatctt
ctcctgggagaagcatacacagtggagtggggcataaagataagggatgaagaaaaaata
gactgttaccctgatgagaatggtgcttctgcagaaaactgcactgcccgtggctgtatc
tgggaggcatccaattcttctggagtccctttttgctattttgtcaacgacctatactct
gtcagtgatgttcagtataactcccatggggccacagctgacatctccttaaagtcttcc
gtttatgccaatgccttcccctccacacccgtgaacccccttcgcctggatgtcacttac
cataagaatgaaatgctgcagttcaagatttatgatcccaacaacaatcggtatgaagtt
ccagtccctctgaacatacccagcgtgccatccagcacccctgagggtcaactctatgat
gtcctcattaagaagaatccatttgggattgaaattcgccggaagagtacaggcactata
atttgggactctcagctccttggcttcaccttcagtgacatgtttatccgcatctccacc
cgccttccctccaagtacctctatggctttggggaaactgagcacaggtcctacaggaga
gacttggagtggcacacttgggggatgttctcccgagaccagcccccagggtacaagaag
aattcctatggtgtccacccgtactacatggggctggaggaggacggcagtgctcatgga
gtgctcctgctgaacagcaatgccatggatgtgacattccagcccctgcctgccttgaca
taccgcaccacagggggagttctggacttttatgtgttcttggggccgactccagagctt
gtcacccagcagtacactgagttgattggccggcctgtgatggtaccttactggtctttg
gggttccagctgtgtcgctatggctaccagaacgactctgagatcgccagcttgtatgat
gagatggtggctgcccagatcccttatgacgtgcagtactcagacatcgactacatggag
cggcagctggacttcaccctcagccccaagtttgctgggtttccagctctgatcaatcgc
atgaaggctgatgggatgcgggtcatcctcattctggatccagccatttctggcaatgag
acacagccttatcctgccttcactcggggcgtggaggatgacgtcttcatcaagtaccca
aatgatggagacattgtctggggaaaggtctggcctgattttcctgatgtggttgtgaat
gggtctctagactgggacagccaagtggagctatatcgagcttatgtggccttcccagac
tttttccgtaattcaactgccaagtggtggaagagggaaatagaagaactatacaacaat
ccacaggatccagagaggagcttgaagtttgatggcatgtggattgatatgaatgaacca
tcaagcttcgtgaatggggcagtttctccaggctgcagggacgcctctctgaaccaccct
ccctacatgccacatttggagtctagggacaggggcctgagcagcaagaccctgtgcatg
gagagtcagcagatcctcccagacggctccccggtgcagcactacaatgtgcacaacctg
tacgggtggtcccagaccagacccacatacgaagccgtgcaggaggtgacaggacagcga
ggggtcgtcatcacccgctccacatttccctcttctggccgctgggcaggacattggctg
ggagacaacacggccgcgtgggatcagctgaagaaatctatcattggcatgatggagttc
agcctcttcggcatatcctatacgggagcagatatctgtgggttctttgaagatgctgaa
tatgagatgtgtgttcgctggatgcagctgggggccttttaccccttctcaagaaaccac
aacaccattgggaccaggagacaagaccctgtgtcctgggacgctgcttttgtgaatatt
tccagaaatgtcctgcagaccagatacaccctgttgccatatctgtataccttgatgcat
aaggcccacacggagggcgtcactgttgtgcggcctctgctccatgagtttgtgtcagac
caggtgacatgggacatagacagtcagttcctgctgggcccagccttcctggtcagccct
gtcctggagcgcgtgagtatggaggcctccgatgaggggaggatcccagctgtgaggctt
ggggaaaaggacgaggagaaggggcctgagctggttctctttgtcgggtttcctggttcc
tacctccatttcctaacaaaaggcatctctggcatgcccacttctctcaagattctccgt
gatgtgacccactgtcttctcacatcctcgacagccagacgcatgtag

DBGET integrated database retrieval system