KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101127499Help
Entry
101127499         CDS       T02442                                 

Gene name
CDC23
Definition
(RefSeq) cell division cycle 23
  KO
K03355  anaphase-promoting complex subunit 8
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04110  Cell cycle
ggo04114  Oocyte meiosis
ggo04120  Ubiquitin mediated proteolysis
ggo04914  Progesterone-mediated oocyte maturation
ggo05166  HTLV-I infection
Module
ggo_M00389  APC/C complex
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101127499 (CDC23)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101127499 (CDC23)
   04114 Oocyte meiosis
    101127499 (CDC23)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101127499 (CDC23)
 09160 Human Diseases
  09167 Infectious diseases
   05166 HTLV-I infection
    101127499 (CDC23)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ggo04121]
    101127499 (CDC23)
   03036 Chromosome and associated proteins [BR:ggo03036]
    101127499 (CDC23)
Ubiquitin system [BR:ggo04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     101127499 (CDC23)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    101127499 (CDC23)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC8 TPR_1 TPR_2 TPR_8 TPR_14 TPR_19 TPR_11 TPR_7 ANAPC3 TPR_16 TPR_17 TPR_12 TPR_9 DUF772 TPR_15
Motif
Other DBs
NCBI-GeneID: 101127499
NCBI-ProteinID: XP_018882873
Ensembl: ENSGGOG00000008867
UniProt: G3SFE4
LinkDB All DBs
Position
5
AA seq 597 aa AA seqDB search
MAASTSIVPVAVTAAVAPVLSINSDFSDLREIKKQLLLIAGLTRERGLLHSSKWSAELAF
SLPALPLAELQPPPPITEEDAQDMDAYTLAKAYFDVKEYDRAAHFLHGCNSKKAYFLYMY
SRYLSGEKKKDDETVDSLGPLEKGQVKNEALRELRVELSKKHQARELDGFGLYLYGVVLR
KLDLVKEAIDVFVEATHVLPLHWGAWLELCNLITDKEMLKFLSLPDTWMKEFFLAHIYTE
LQLIEEALQKYQNLIDVGFSKSSYIVSQIAVAYHNIRDIDKALSIFNELRKQDPYRIENM
DTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQRALKL
NPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPFYCLY
YYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVEKMALVKLAKLHEQL
TESEQAAQCYIKYIQDIYSCGEIVEHLEESTAFRYLAQYYFKCKLWDEASTCAQKCCAFN
DTREEGKALLRQILQLRNQGETPTTEVPAPFFLPASLSANNTPTRRVSPLNLSSVTP
NT seq 1794 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagtacttccatagtcccggtggctgtgacggcggcagtggcgcctgtcctg
tccataaacagcgatttctcagatttgcgggaaattaaaaagcaactgctgcttattgcg
ggccttacccgggagcggggcctactacacagtagcaaatggtcggcggagttggctttc
tctcttcctgcattgcctctggccgagctgcaaccgcctccgcctattacagaggaagat
gcccaggatatggatgcctataccctggccaaggcctactttgacgttaaagagtatgat
cgggcagcacatttcctgcatggctgcaatagcaagaaagcctattttctgtatatgtat
tccagatatctgtctggagaaaaaaagaaggacgatgaaacagttgatagcttaggcccc
ctggaaaaaggacaagtgaaaaatgaggctcttagagaattgagagtggagctcagcaaa
aaacaccaagctcgagaacttgatggatttggactttatctgtatggtgtggtgcttcga
aaactggacttggttaaagaggccatcgatgtgtttgtggaagctactcatgttttgccc
ttgcattggggagcctggttagaactctgtaacctgatcacagacaaagagatgctgaag
ttcctgtctttgccagacacctggatgaaagagttttttctggctcatatatacacagag
ttgcagttgatagaggaggccctgcaaaagtatcagaatctcattgatgtgggcttctct
aagagctcatatattgtttcccaaattgcagttgcctatcacaatatcagagatattgac
aaagccctctccatttttaatgagctaaggaaacaagacccttacaggattgaaaatatg
gacacattctccaaccttctttatgtcaggagcatgaaatcggagttgagttatctggct
cataacctctgtgagattgataaatatcgtgtagaaacgtgctgtgtaattggcaattat
tacagtttacgttctcagcatgagaaggcagccttatatttccagagagccctgaaatta
aatcctcggtatcttggtgcctggacactgatgggacatgagtacatggagatgaagaac
acgtctgctgctatccaggcttatagacatgccattgaggtcaacaaacgggactacaga
gcttggtatggcctcgggcagacctatgaaatccttaagatgccattttactgcctttat
tattatagacgggcccaccagcttcgacccaatgattctcgcatgctggttgctttagga
gaatgttatgagaaactcaatcaactagtggaagccaaaaagtgttattggagagcttac
gccgtgggagatgtggagaaaatggctctggtgaaactggcaaagcttcatgaacagttg
actgagtcagaacaggctgcccagtgttacatcaaatatatccaagatatctattcctgt
ggggaaatagtagaacacttggaggaaagcactgcctttcgctatctggcccagtactat
tttaagtgcaaactgtgggatgaagcttcaacttgtgcacaaaagtgttgtgcatttaat
gatacccgggaagaaggtaaggccttactccggcaaatcctacagcttcggaaccagggc
gagactcctaccaccgaggtgcctgctccttttttcctacccgcttcactctctgctaac
aatacccccacacgcagagtttctccactcaacttgtcttctgtcacgccatag

DBGET integrated database retrieval system