KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101129357
Entry
101129357         CDS       T02442                                 

Gene name
PLCB3
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00562  Inositol phosphate metabolism
ggo01100  Metabolic pathways
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04062  Chemokine signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04310  Wnt signaling pathway
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04621  NOD-like receptor signaling pathway
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04742  Taste transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04973  Carbohydrate digestion and absorption
ggo05010  Alzheimer disease
ggo05016  Huntington disease
ggo05017  Spinocerebellar ataxia
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05142  Chagas disease
ggo05143  African trypanosomiasis
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05200  Pathways in cancer
Module
ggo_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101129357 (PLCB3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101129357 (PLCB3)
   04310 Wnt signaling pathway
    101129357 (PLCB3)
   04371 Apelin signaling pathway
    101129357 (PLCB3)
   04020 Calcium signaling pathway
    101129357 (PLCB3)
   04070 Phosphatidylinositol signaling system
    101129357 (PLCB3)
   04072 Phospholipase D signaling pathway
    101129357 (PLCB3)
   04071 Sphingolipid signaling pathway
    101129357 (PLCB3)
   04022 cGMP-PKG signaling pathway
    101129357 (PLCB3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101129357 (PLCB3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101129357 (PLCB3)
   04621 NOD-like receptor signaling pathway
    101129357 (PLCB3)
   04062 Chemokine signaling pathway
    101129357 (PLCB3)
  09152 Endocrine system
   04911 Insulin secretion
    101129357 (PLCB3)
   04922 Glucagon signaling pathway
    101129357 (PLCB3)
   04929 GnRH secretion
    101129357 (PLCB3)
   04912 GnRH signaling pathway
    101129357 (PLCB3)
   04915 Estrogen signaling pathway
    101129357 (PLCB3)
   04921 Oxytocin signaling pathway
    101129357 (PLCB3)
   04926 Relaxin signaling pathway
    101129357 (PLCB3)
   04935 Growth hormone synthesis, secretion and action
    101129357 (PLCB3)
   04918 Thyroid hormone synthesis
    101129357 (PLCB3)
   04919 Thyroid hormone signaling pathway
    101129357 (PLCB3)
   04928 Parathyroid hormone synthesis, secretion and action
    101129357 (PLCB3)
   04916 Melanogenesis
    101129357 (PLCB3)
   04924 Renin secretion
    101129357 (PLCB3)
   04925 Aldosterone synthesis and secretion
    101129357 (PLCB3)
   04927 Cortisol synthesis and secretion
    101129357 (PLCB3)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101129357 (PLCB3)
   04270 Vascular smooth muscle contraction
    101129357 (PLCB3)
  09154 Digestive system
   04970 Salivary secretion
    101129357 (PLCB3)
   04971 Gastric acid secretion
    101129357 (PLCB3)
   04972 Pancreatic secretion
    101129357 (PLCB3)
   04973 Carbohydrate digestion and absorption
    101129357 (PLCB3)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101129357 (PLCB3)
  09156 Nervous system
   04724 Glutamatergic synapse
    101129357 (PLCB3)
   04725 Cholinergic synapse
    101129357 (PLCB3)
   04728 Dopaminergic synapse
    101129357 (PLCB3)
   04726 Serotonergic synapse
    101129357 (PLCB3)
   04720 Long-term potentiation
    101129357 (PLCB3)
   04730 Long-term depression
    101129357 (PLCB3)
   04723 Retrograde endocannabinoid signaling
    101129357 (PLCB3)
  09157 Sensory system
   04742 Taste transduction
    101129357 (PLCB3)
   04750 Inflammatory mediator regulation of TRP channels
    101129357 (PLCB3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101129357 (PLCB3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101129357 (PLCB3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101129357 (PLCB3)
   05016 Huntington disease
    101129357 (PLCB3)
   05017 Spinocerebellar ataxia
    101129357 (PLCB3)
   05022 Pathways of neurodegeneration - multiple diseases
    101129357 (PLCB3)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101129357 (PLCB3)
   04934 Cushing syndrome
    101129357 (PLCB3)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101129357 (PLCB3)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101129357 (PLCB3)
   05142 Chagas disease
    101129357 (PLCB3)
   05143 African trypanosomiasis
    101129357 (PLCB3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101129357 (PLCB3)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101129357 (PLCB3)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101129357 (PLCB3)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101129357 (PLCB3)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 BPL_N
Other DBs
NCBI-GeneID: 101129357
NCBI-ProteinID: XP_018891735
Ensembl: ENSGGOG00000012218
UniProt: G3R963
LinkDB
Position
11
AA seq 1234 aa
MAGAQPGVHALQLEPPTVVETLRRGSKFIKWDEETSSRNLVTLRVDPNGFFLYWTGPNME
VDTLDISSIRDTRTGRYARLPKDPKIREVLGFGGPDARLEEKLMTVVSGPDPVNTVFLNF
MAVQDDTAKVWSEELFKLAMNILAQNASRNTFLRKAYTKLKLQVNQDGRIPVKNILKMFS
ADKKRVETALESCGLKFNRSESIRPDEFSLEIFERFLNKLCLRPDIDKILLEIGAKGKPY
LTLEQLMDFINQKQRDPRLNEVLYPPLRPSQARLLIEKYEPNQQFLERDQMSMEGFSRYL
GGEENGILPLEALDLSTDMTQPLSAYFINSSHNTYLTAGQLAGTSSVEMYRQALLWGCRC
VELDVWKGRPPEEEPFITHGFTMTTEVPLRDVLEAIAETAFKTSPYPVILSFENHVDSAK
QQAKMAEYCRSIFGDALLIEPLDKYPLAPGVPLPSPQDLMGRILVKNKKRHRPSAGGPDS
SGRKRPLEQSNSALSESSAATEPSSPQLGSPSSDSCPGLSNGEEVGLEKPSLEPQKSLGD
EGLNRGPYVLGPADREDEEEDEEEEEQTDPKKPTTDEGTASSEVNATEEMSTLVNYIEPV
KFKSFEAARKRNKCFEMSSFVETKAMEQLTKSPMEFVEYNKQQLSRIYPKGTRVDSSNYM
PQLFWNVGCQLVALNFQTLDVAMQLNAGVFEYNGRSGYLLKPEFMRRPDKSFDPFTEVIV
DGIVANALRVKVISGQFLSDRKVGIYVEVDMFGLPVDTRRKYRTRTSQGNSFNPVWDEEP
FDFPKVVLPTLASLRIAAFEEGGKFVGHRILPVSAIRSGYHYVCLRNEANQPLCLPALLI
YTEASDYIPDDHQDYAEALINPIKHVSLMDQRARQLAALIGESEAQAGQETCQDTQSQQL
GSQPSSNPTPSPLDASPRRPPGPTTSPTSTSLSSPGQRDDLIASILSEVAPTPLDELRGH
KALVKLRSRQERDLRELRKKHQRKAVTLTRRLLDGLAQAQAEGRCRLRPGALGGAADVED
TKEGEDEAKRYQEFQNRQVQSLLELREAQVDAEAQRRLEHLRQALQRLREVVLDANTTQF
KRLKEMNEREKKELQKILDRKRHNSISEAKMRDKHKKEAELTEINRRHITESVNSIRRLE
EAQKQRHDRLVAGQQQVLQQLAEEEPKLLAQLAQECQEQRARLPQEIRRSLLGEMPEGLG
DGPLVACASNGHAPGSSGHLSGADSESQEENTQL
NT seq 3705 nt   +upstreamnt  +downstreamnt
atggcgggcgcccagcccggcgtccacgcgctgcagctggagccgcccaccgtggtggag
accctgcggcgcgggagtaagttcatcaaatgggacgaggagacctccagtcggaacctg
gtgactctgcgtgtggaccccaatggcttcttcttgtactggacgggccccaacatggag
gtggacacactggacatcagttccatcagggacacacggacaggccggtacgcccgcctg
cccaaggaccccaagatccgggaagttctgggctttgggggtcccgatgcccggctggag
gagaagctgatgacggtggtgtctgggccagacccggtgaacacagtgttcttgaacttc
atggccgtgcaggatgacacagccaaggtctggtctgaggagctattcaagctggctatg
aacatcctggctcagaacgcctctcggaacaccttcctgcgcaaagcatacacgaagctg
aagctgcaggtgaaccaggatggtcggatccccgtcaagaacatcctgaagatgttctca
gcagacaagaagcgggtggagactgcgctggaatcctgtggcctcaaattcaaccggagt
gagtccatccggcccgatgagttttccttggaaatctttgagcggttcctgaacaagctg
tgtctgcggccggacattgacaagatcctgctggagataggcgccaagggcaagccatac
ctgacgctggagcagctcatggacttcatcaaccagaagcaacgtgacccgagactcaac
gaagtgctgtacccgcccctgcggccctcccaggcccggctgctcatcgaaaagtatgag
cccaaccagcagtttctggagcgagaccagatgtccatggagggctttagccgctacctg
ggaggcgaggagaatggcatcctgcccctggaagccctggatctgagcacggacatgacc
cagccactgagtgcctacttcatcaactcctcgcataacacctatctcactgcggggcag
ctggctgggacctcgtcggtggagatgtaccgccaggcactgctatggggctgccgctgc
gtggagctggatgtgtggaagggacggccgcccgaggaggaacccttcattacccatggc
ttcaccatgaccacagaggtgcctctgcgcgacgtgctggaggccattgccgagactgcc
ttcaagacctcgccctaccccgtcatcctctccttcgagaaccatgtggactcggcaaag
caacaggcaaagatggctgagtactgccgctccatctttggagacgcgctactcatcgag
cctctggacaagtacccgctggccccaggcgttcccctgcccagcccccaggacctgatg
ggccgtatcctggtgaagaacaagaagcggcaccgacccagcgcaggtggcccagacagc
tccgggcgcaagcggcccctggagcagagcaattctgccctgagtgagagctccgcggcc
actgagccctcctccccgcagcttgggtctcccagctctgacagctgcccaggcctgagc
aacggggaggaggtagggcttgagaagcccagcctggagcctcagaagtctctgggcgac
gagggcctgaaccggggcccctatgttcttggacctgctgaccgtgaggatgaggaggaa
gatgaagaagaggaggaacagacagaccccaaaaagccaactacagatgagggcacagcc
agcagcgaggtgaatgccactgaggagatgtccacgcttgtcaactacatcgagcctgtc
aagttcaagtcctttgaggctgctcgaaagaggaacaaatgcttcgagatgtcgtccttc
gtggagaccaaggccatggagcaactgaccaagagccccatggagtttgtggaatacaac
aagcagcagctcagccgcatctaccccaagggcacccgcgtggactcctccaactatatg
ccccagctcttctggaacgtagggtgccagcttgttgcgctcaacttccagaccctcgat
gtggcgatgcagctcaacgcgggcgtttttgagtacaacgggcgcagcgggtacctgctc
aagccggagttcatgcggcggccggacaagtccttcgaccccttcactgaggtcatcgtg
gatggcatcgtggccaatgccttgcgggtcaaggtgatctcagggcagttcctgtccgac
aggaaggtgggcatctacgtggaggtggacatgtttggcctccctgttgacacgcggcgc
aagtaccgcacccggacctctcaggggaactcgttcaaccccgtgtgggacgaagagccc
ttcgacttccccaaggtggtgctgcccacgctggcttcacttcgcatcgcagcctttgag
gaggggggtaaattcgtagggcaccggatcctgcctgtctctgccatccgctccggatac
cactacgtctgcctgcggaacgaggccaaccaaccgctgtgcctgccggccctgctcatc
tacaccgaagcctcggactacattcctgacgaccaccaggactacgcggaggccctgatc
aaccccattaagcacgtcagcctgatggaccagagggcccggcagctggccgccctcatt
ggagagagtgaggctcaggctggccaagagacgtgccaggacacccagtctcagcagctg
gggtctcagccgtcctcaaaccccacccctagcccactggatgcctccccccgccggccc
cctggccccaccacctcccctaccagcacctccctcagcagcccagggcagcgcgacgat
ctcatcgccagcatcctctcagaggtggcccccaccccgctggatgagctccgaggtcac
aaggctttggtcaagctccggagccggcaagagcgagacctgcgggagctgcgcaagaag
catcagcggaaggcagtcaccctcacccgccgcctgctggacggcctggctcaggcacag
gctgagggcaggtgccggctgcggccaggtgccctaggtggggccgctgatgtggaggac
acgaaggagggggaggacgaggcaaagcggtatcaggagttccagaacagacaggtgcag
agcctgctggagctgcgggaggcccaggtggacgcagaggcccagcggaggctggaacac
ctgagacaggctctgcagcggctcagggaggtcgtccttgatgcaaacacaactcagttc
aagaggctgaaagagatgaacgagagggagaagaaggagctgcagaagatcctggacaga
aagcgccataacagcatctcggaggccaagatgagggacaagcataagaaggaggcggaa
ctgacggagattaaccgtcggcacatcactgagtcagtcaactccatccgtcggctggag
gaggcccagaagcagcggcatgaccgtcttgtggctgggcagcagcaggtcctgcaacag
ctggcagaagaggagcccaagctgctggcccagctggcccaggagtgtcaggagcagcgg
gcgaggctcccccaggagatccgccggagcctgctgggcgagatgccggaggggctgggg
gacgggcctctggtggcctgtgccagcaacggtcatgcacccgggagcagcgggcacctg
tcgggcgctgactcggagagccaggaggagaacacgcagctctga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101140350
Entry
101140350         CDS       T02442                                 

Gene name
PLCB2
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00562  Inositol phosphate metabolism
ggo01100  Metabolic pathways
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04062  Chemokine signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04310  Wnt signaling pathway
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04621  NOD-like receptor signaling pathway
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04742  Taste transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04973  Carbohydrate digestion and absorption
ggo05010  Alzheimer disease
ggo05016  Huntington disease
ggo05017  Spinocerebellar ataxia
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05142  Chagas disease
ggo05143  African trypanosomiasis
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05200  Pathways in cancer
Module
ggo_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101140350 (PLCB2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101140350 (PLCB2)
   04310 Wnt signaling pathway
    101140350 (PLCB2)
   04371 Apelin signaling pathway
    101140350 (PLCB2)
   04020 Calcium signaling pathway
    101140350 (PLCB2)
   04070 Phosphatidylinositol signaling system
    101140350 (PLCB2)
   04072 Phospholipase D signaling pathway
    101140350 (PLCB2)
   04071 Sphingolipid signaling pathway
    101140350 (PLCB2)
   04022 cGMP-PKG signaling pathway
    101140350 (PLCB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101140350 (PLCB2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101140350 (PLCB2)
   04621 NOD-like receptor signaling pathway
    101140350 (PLCB2)
   04062 Chemokine signaling pathway
    101140350 (PLCB2)
  09152 Endocrine system
   04911 Insulin secretion
    101140350 (PLCB2)
   04922 Glucagon signaling pathway
    101140350 (PLCB2)
   04929 GnRH secretion
    101140350 (PLCB2)
   04912 GnRH signaling pathway
    101140350 (PLCB2)
   04915 Estrogen signaling pathway
    101140350 (PLCB2)
   04921 Oxytocin signaling pathway
    101140350 (PLCB2)
   04926 Relaxin signaling pathway
    101140350 (PLCB2)
   04935 Growth hormone synthesis, secretion and action
    101140350 (PLCB2)
   04918 Thyroid hormone synthesis
    101140350 (PLCB2)
   04919 Thyroid hormone signaling pathway
    101140350 (PLCB2)
   04928 Parathyroid hormone synthesis, secretion and action
    101140350 (PLCB2)
   04916 Melanogenesis
    101140350 (PLCB2)
   04924 Renin secretion
    101140350 (PLCB2)
   04925 Aldosterone synthesis and secretion
    101140350 (PLCB2)
   04927 Cortisol synthesis and secretion
    101140350 (PLCB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101140350 (PLCB2)
   04270 Vascular smooth muscle contraction
    101140350 (PLCB2)
  09154 Digestive system
   04970 Salivary secretion
    101140350 (PLCB2)
   04971 Gastric acid secretion
    101140350 (PLCB2)
   04972 Pancreatic secretion
    101140350 (PLCB2)
   04973 Carbohydrate digestion and absorption
    101140350 (PLCB2)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101140350 (PLCB2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101140350 (PLCB2)
   04725 Cholinergic synapse
    101140350 (PLCB2)
   04728 Dopaminergic synapse
    101140350 (PLCB2)
   04726 Serotonergic synapse
    101140350 (PLCB2)
   04720 Long-term potentiation
    101140350 (PLCB2)
   04730 Long-term depression
    101140350 (PLCB2)
   04723 Retrograde endocannabinoid signaling
    101140350 (PLCB2)
  09157 Sensory system
   04742 Taste transduction
    101140350 (PLCB2)
   04750 Inflammatory mediator regulation of TRP channels
    101140350 (PLCB2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101140350 (PLCB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101140350 (PLCB2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101140350 (PLCB2)
   05016 Huntington disease
    101140350 (PLCB2)
   05017 Spinocerebellar ataxia
    101140350 (PLCB2)
   05022 Pathways of neurodegeneration - multiple diseases
    101140350 (PLCB2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101140350 (PLCB2)
   04934 Cushing syndrome
    101140350 (PLCB2)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101140350 (PLCB2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101140350 (PLCB2)
   05142 Chagas disease
    101140350 (PLCB2)
   05143 African trypanosomiasis
    101140350 (PLCB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101140350 (PLCB2)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101140350 (PLCB2)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101140350 (PLCB2)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101140350 (PLCB2)
SSDB
Motif
Pfam: PLC-beta_C PI-PLC-X PH_14 PI-PLC-Y EF-hand_like C2 DUF1154 Gp58
Other DBs
NCBI-GeneID: 101140350
NCBI-ProteinID: XP_004056019
Ensembl: ENSGGOG00000000759
UniProt: G3QEQ0
LinkDB
Position
15
AA seq 1185 aa
MSLLNPVLLPPKVKAYLSQGERFIKWDDETTVASPVILRVDPKGYYLYWTYQSKEMEFLD
ITSIRDTRFGKFAKMPKSQKLRDVFNMDFPDNSFLLKTLTVVSGPDMVDLTFHNFVSYKE
NVGKVWAEDVLALVKHPLTANASRSTFLDKILVKLKMQLNSEGKIPVKNFFQMFPADRKR
VEAALSACHLPKGKNDAINPEDFPEPVYKSFLMSLCPRPEIDEIFTSYHAKAKPYMTKEH
LTKFINQKQRDSRLNSLLFPPARPDQVQGLIDKYEPSGINAQRGQLSPEGMVWFLCGPEN
SVLAQDKLLLHHDMTQPLNHYFINSSHNTYLTAGQFSGLSSAEMYRQVLLSGCRCVELDC
WKGKPPDEEPIITHGFTMTTDIFFKEAIEAIAESAFKTSPYPIILSFENHVDSPRQQAKM
AEYCRTIFGDMLLTEPLEKFPLKPGVPLPSPEDLRGKILIKNKKNQFSGSTSSSKDTGGE
AEGSSPPSAPAGEGTVWAGEEGTELEEEEVEEEEEEESGNLDEEEIKKMQSDEGTAGLEV
TAYEEMSSLVNYIQPTKFISFEFSAQKNRSYVISSFTELKAFDLLSKASVQFVDYNKRQM
SRIYPKGTRMDSSNYMPQMFWNAGCQMVALNFQTMDLPMQQNMAVFEFNGQSGYLLKHEF
MRRPDKQFNPFSVDRIDVVVATTLSITVISGQFLSERSVRTYVEVELFGLPGDPKRRYRT
KLSPSTNSINPVWKEEPFVFEKILMPELASLRVAVMEEGNKFLGHRIIPINALNSGYHHL
CLHSESNMPLTMPALFIFLEMKDYIPGAWADLTVALANPIKFFSAHDTKSVKLKEAMGGL
PEKPFPLASPVASQVNGALAPTSNGSPAARAGAREEAMKEAAEPRTASLEELRELKGVVK
LQRRHEKELRELERRGARRWEELLQRGAAQLAELQPPGVGGVGACKLGPGKGSRKKRSLP
REESAGASPGEGPEGVDGRVRELKDRLELELLRQGEEQYECVLKRKEQHAAEQISKMMEL
AREKQAAELKALKETSENDTKEMKKKLETKRLERIQGMTKVTTDKMAQERLKREINNSHI
QEVVQVIKQMTENLKRHQEKLEEKQAACLEQIREMEKQFQKEALAEYEARMKGLEAEVKE
VVRVYLRTCFPSEAKDKPERACECPPELCEQDPLIAKADAQESRL
NT seq 3558 nt   +upstreamnt  +downstreamnt
atgtctctgctcaaccctgtcctgctgccccccaaggtgaaggcctatctgagccaaggg
gagcgcttcatcaaatgggatgatgaaactacagttgcctctccagttatcctccgtgtg
gatcctaagggctactacttatactggacgtatcaaagtaaggagatggagtttctggat
atcaccagcatccgggatactcgctttgggaagtttgccaagatgcccaagagccagaag
ctccgggacgtcttcaacatggactttcctgacaacagtttcctgctgaagacactcacg
gtggtgtccggcccggacatggtggacctcaccttccacaacttcgtctcctacaaggag
aatgtgggcaaggtctgggctgaggacgtactggccctagtcaaacatccgctgacggcc
aacgcctcccgcagcaccttcctggacaagatccttgtgaagctcaagatgcagctcaac
tctgaagggaagattccggtgaagaactttttccagatgtttcctgctgaccgcaagcgg
gtggaagctgctctcagtgcctgccacctccccaaaggcaaaaatgacgccatcaatcct
gaggacttcccagaacctgtctacaagagtttcctcatgagcctctgtcctcggccagaa
atagatgagatcttcacttcttaccatgctaaggccaaaccctacatgacgaaggagcac
ctgaccaaattcatcaaccagaaacagcgggactcccggcttaactccctgctgttcccg
ccagcacggcctgaccaggtgcagggcctcatcgacaagtatgagcccagtggcatcaat
gcacagaggggccagctgtcacctgaaggcatggtctggtttctctgtgggccagagaac
agcgtgctggcccaggacaagctgctgctccaccacgacatgacgcagccactcaatcat
tacttcatcaactcgtcccacaacacctacctgacagccggccagttctcaggcctctcc
tcggctgagatgtaccgccaggtgctgctctctggctgccgttgcgtggagctagactgc
tggaaggggaaaccccctgacgaggagcccattatcacccatggcttcaccatgaccaca
gacatcttcttcaaagaagcaattgaggctattgcagaaagtgcctttaagacctccccc
tatcccatcatcctgtcgtttgagaaccatgtggactcaccccgccagcaggctaagatg
gctgagtattgccggacgatctttggggatatgctgctcacagagcccctggaaaagttc
ccactaaaaccaggtgtccccctgcccagccctgaggatctcaggggcaagatcctcatc
aagaacaagaagaaccagttttctggctccacctcctccagtaaggatactggtggggag
gctgagggcagcagcccacctagtgcccctgcaggtgagggcacagtgtgggctggcgag
gaagggactgagctggaggaggaggaggtggaagaggaagaagaggaggagtcaggaaac
ctggatgaagaagagattaagaagatgcagtcggatgagggcacagcgggcctggaagtg
acggcttatgaggagatgtccagcctagtcaattacatccagcccaccaagttcatctcc
tttgagttctctgcccaaaagaaccgaagttatgtcatctcgtccttcacagagctcaag
gcatttgacctgctctccaaggcctcggtgcagtttgtggactacaacaagcgccagatg
agccgcatttaccccaagggaacccgcatggactcctccaactacatgccccagatgttc
tggaatgctggatgccagatggttgccctcaacttccagacgatggacttgcccatgcag
cagaacatggcagtgtttgagttcaacgggcagagtggctacctcctcaagcatgagttc
atgcgccggccggacaagcagttcaaccccttctcagtggaccgcatcgacgtggtggtg
gccaccaccctttccattacggtgatctctgggcagttcctgtcagaacgcagcgtgcgc
acctatgtggaagtggagctgtttggccttcctggggaccccaagaggcgctatcgaact
aagctgtcacccagtaccaactccatcaatcctgtctggaaggaggaaccctttgtcttt
gagaagatcttgatgcctgagctggcctccctcagagtggctgtgatggaggaaggcaac
aagtttcttggacaccgcatcatccccatcaatgccctaaattctgggtaccaccacctg
tgcctgcacagtgagagcaacatgcccctcaccatgcctgcgctcttcatcttcctggag
atgaaggactacatacctggtgcttgggcagatctcactgtggccctcgccaaccccatt
aagttcttcagtgcccatgacacgaagtctgtgaagctcaaggaggccatgggaggtctg
cctgagaagcccttcccactggcgagtccagttgccagccaggtcaatggggcgttggcc
ccaacgagcaatgggtcaccagcagccagggccggggccagggaagaggctatgaaagaa
gctgcggagccgcggaccgccagcctggaggagctccgggagctaaagggcgtggtgaag
ctgcagcggcggcacgagaaggagctgcgagagttggagcggcgcggagcgcggcgctgg
gaggagctgctgcagcggggcgcggcgcagctggcggagctccagccaccgggcgtgggg
ggcgtcggggcctgcaagctcggtcccggcaagggctctcgcaagaagaggagcctgccc
cgcgaggagagcgccggagcctcgccgggcgagggccctgagggcgtggacgggcgcgtg
cgggagctgaaagacaggctggagctggagctgctgcggcagggcgaggagcagtacgag
tgcgttctgaagcgcaaggagcagcacgcggccgagcaaatctccaaaatgatggagctg
gccagagagaaacaggcggcagagctgaaggccctgaaggagacgtcggagaacgacacc
aaagagatgaagaaaaagctggagacaaagagactggagcggatccagggcatgaccaaa
gtcaccacagacaagatggcccaggagaggttgaagagagagattaacaactcccacatc
caggaagtagtacaggtgatcaagcagatgacggagaacttgaagaggcaccaggagaag
ctggaggagaagcaggcagcttgcctggaacagatacgggagatggaaaagcagttccag
aaggaggcgctggcagagtacgaggccaggatgaagggtctggaggcagaggtgaaggag
gtggtgagggtctacctcaggacctgctttccctctgaagccaaggacaagcctgagagg
gcctgcgagtgccccccagagctgtgtgagcaggacccactcatagcaaaggcagatgcc
caggagagccgcctctga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101153613
Entry
101153613         CDS       T02442                                 

Gene name
PLCB1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1 isoform X1
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00562  Inositol phosphate metabolism
ggo01100  Metabolic pathways
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04062  Chemokine signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04310  Wnt signaling pathway
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04621  NOD-like receptor signaling pathway
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04742  Taste transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04973  Carbohydrate digestion and absorption
ggo05010  Alzheimer disease
ggo05016  Huntington disease
ggo05017  Spinocerebellar ataxia
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05142  Chagas disease
ggo05143  African trypanosomiasis
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05200  Pathways in cancer
Module
ggo_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101153613 (PLCB1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101153613 (PLCB1)
   04310 Wnt signaling pathway
    101153613 (PLCB1)
   04371 Apelin signaling pathway
    101153613 (PLCB1)
   04020 Calcium signaling pathway
    101153613 (PLCB1)
   04070 Phosphatidylinositol signaling system
    101153613 (PLCB1)
   04072 Phospholipase D signaling pathway
    101153613 (PLCB1)
   04071 Sphingolipid signaling pathway
    101153613 (PLCB1)
   04022 cGMP-PKG signaling pathway
    101153613 (PLCB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101153613 (PLCB1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101153613 (PLCB1)
   04621 NOD-like receptor signaling pathway
    101153613 (PLCB1)
   04062 Chemokine signaling pathway
    101153613 (PLCB1)
  09152 Endocrine system
   04911 Insulin secretion
    101153613 (PLCB1)
   04922 Glucagon signaling pathway
    101153613 (PLCB1)
   04929 GnRH secretion
    101153613 (PLCB1)
   04912 GnRH signaling pathway
    101153613 (PLCB1)
   04915 Estrogen signaling pathway
    101153613 (PLCB1)
   04921 Oxytocin signaling pathway
    101153613 (PLCB1)
   04926 Relaxin signaling pathway
    101153613 (PLCB1)
   04935 Growth hormone synthesis, secretion and action
    101153613 (PLCB1)
   04918 Thyroid hormone synthesis
    101153613 (PLCB1)
   04919 Thyroid hormone signaling pathway
    101153613 (PLCB1)
   04928 Parathyroid hormone synthesis, secretion and action
    101153613 (PLCB1)
   04916 Melanogenesis
    101153613 (PLCB1)
   04924 Renin secretion
    101153613 (PLCB1)
   04925 Aldosterone synthesis and secretion
    101153613 (PLCB1)
   04927 Cortisol synthesis and secretion
    101153613 (PLCB1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101153613 (PLCB1)
   04270 Vascular smooth muscle contraction
    101153613 (PLCB1)
  09154 Digestive system
   04970 Salivary secretion
    101153613 (PLCB1)
   04971 Gastric acid secretion
    101153613 (PLCB1)
   04972 Pancreatic secretion
    101153613 (PLCB1)
   04973 Carbohydrate digestion and absorption
    101153613 (PLCB1)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101153613 (PLCB1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101153613 (PLCB1)
   04725 Cholinergic synapse
    101153613 (PLCB1)
   04728 Dopaminergic synapse
    101153613 (PLCB1)
   04726 Serotonergic synapse
    101153613 (PLCB1)
   04720 Long-term potentiation
    101153613 (PLCB1)
   04730 Long-term depression
    101153613 (PLCB1)
   04723 Retrograde endocannabinoid signaling
    101153613 (PLCB1)
  09157 Sensory system
   04742 Taste transduction
    101153613 (PLCB1)
   04750 Inflammatory mediator regulation of TRP channels
    101153613 (PLCB1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101153613 (PLCB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101153613 (PLCB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101153613 (PLCB1)
   05016 Huntington disease
    101153613 (PLCB1)
   05017 Spinocerebellar ataxia
    101153613 (PLCB1)
   05022 Pathways of neurodegeneration - multiple diseases
    101153613 (PLCB1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101153613 (PLCB1)
   04934 Cushing syndrome
    101153613 (PLCB1)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101153613 (PLCB1)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101153613 (PLCB1)
   05142 Chagas disease
    101153613 (PLCB1)
   05143 African trypanosomiasis
    101153613 (PLCB1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101153613 (PLCB1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101153613 (PLCB1)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101153613 (PLCB1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101153613 (PLCB1)
SSDB
Motif
Pfam: PI-PLC-X PLC-beta_C PH_14 PI-PLC-Y EF-hand_like DUF1154
Other DBs
NCBI-GeneID: 101153613
NCBI-ProteinID: XP_018873017
UniProt: A0A2I2Z963
LinkDB
Position
20
AA seq 1216 aa
MAGAQPGVHALQLKPVCVSDSLKKGTKFVKWDDDSTIVTPIILRTDPQGFFFYWTDQNKE
TELLDLSLVKDARCGRHAKAPKDPKLRELLDVGNIGRLEQRMITVVYGPDLVNISHLNLV
AFQEEVAKEWTNEVFSLATNLLAQNMSRDAFLEKAYTKLKLQVTPEGRIPLKNIYRLFSA
DRKRVETALEACSLPSSRNDSIPQEDFTPEVYRVFLNNLCPRPEIDNIFSEFGAKSKPYL
TVDQMMDFINLKQRDPRLNEILYPPLKQEQVQVLIEKYEPNNSLARKGQISVDGFMRYLS
GEENGVVSPEKLDLNEDMSQPLSHYFINSSHNTYLTAGQLAGNSSVEMYRQVLLSGCRCV
ELDCWKGRTAEEEPVITHGFTMTTEISFKEVIEAIAECAFKTSPFPILLSFENHVDSPKQ
QAKMAEYCRLIFGDALLMEPLEKYPLESGVPLPSPMDLMYKILVKNKKKSHKSSEGSGKK
KLSEQASNTYSDSSSMFEPSSPGAGEADTESDDDDDDDDCKKSSMDEGTAGSEAMATEEM
SNLVNYIQPVKFESFEISKKRNKSFEMSSFVETKGLEQLTKSPVEFVEYNKMQLSRIYPK
GTRVDSSNYMPQLFWNAGCQMVALNFQTMDLAMQINMGMYEYNGKSGYRLKPEFMRRPDK
HFDPFTEGIVDGIVANTLSVKIISGQFLSDKKVGTYVEVDMFGLPVDTRRKAFKTKTSQG
NAVNPVWEEEPIVFKKVVLPTLACLRIAVYEEGGKFIGHRILPVQAIRPGYHYICLRNER
NQPLTLPAVFVYIEVKDYVPDTYADVIEALSNPIRYVNLMEQRAKQLAALTLEDEEEVKK
EADPGETPSEAPSEARTTPAENGVNHTTTLTPKPPSQALHSQPAPGSVKAPAKTEDLIQS
VLTEVEAQTIEELKQQKSFVKLQKKHYKEMKDLVKRHHKKTTDLIKEHTTKYNEIQNDYL
RRRAALEKSAKKDSKKKSEPSSPDHGSSTIEQDLAALDAEMTQKLIDLKDKQQQQLLNLR
QEQYYSEKYQKREHIKLLIQKLTDVAEECQNNQLKKLKEICEKEKKELKKKMDKKRQEKI
TEAKSKDKSQMEEEKTEMIRSYIQEVVQYIKRLEEAQSKRQEKLVEKHKEIRQQILDEKP
KLQVELEQEYQDKFKRLPLEILEFVQEAMKGKISEDSNHGSAPLSLSSDPGKVNHKTPSS
EELGGDIPGKEFDTPL
NT seq 3651 nt   +upstreamnt  +downstreamnt
atggccggggctcaacccggagtgcacgccttgcaactcaagcccgtgtgcgtgtccgac
agcctcaagaagggcaccaaattcgtcaagtgggatgatgactcaactattgttactcca
attattttgaggactgaccctcagggatttttcttttactggacagatcaaaacaaggag
acagagctactggatctcagccttgtcaaagatgccagatgtgggagacacgccaaagct
cccaaggaccccaaattacgtgaacttttggatgtggggaacatcgggcgcctggagcag
cgcatgatcacagtggtgtatgggcctgacctcgtgaacatctcccatttgaatctcgtg
gctttccaagaagaagtggccaaggaatggacaaatgaggttttcagtttggcaacaaac
ctgctggcccaaaacatgtccagggatgcatttctggaaaaagcctatactaaacttaag
ctgcaagtcactccagaagggcgtattcctctcaaaaacatatatcgcttgttttcagca
gaccggaagcgagttgaaactgctttagaggcttgtagtcttccatcttcaaggaatgat
tcaatacctcaagaagatttcactccagaagtgtacagagttttcctcaacaacctttgc
cctcgacctgaaattgataacatcttttcagaatttggtgccaaaagcaaaccatatctt
accgttgatcagatgatggattttatcaaccttaagcagcgagatcctcggcttaatgaa
atactttatccacctctaaaacaagagcaagtccaagtattgattgagaagtatgaaccc
aacaacagcctcgccagaaaaggacaaatatcagtggatgggttcatgcgctatctgagt
ggagaagaaaacggagtcgtttcacctgagaaactggatttgaatgaagacatgtctcag
cccctttctcactatttcattaattcctcgcacaacacctacctcacagctggccaactg
gctggaaactcctctgttgagatgtatcgccaagtgctcctgtctggttgtcgctgtgtg
gagctggactgctggaagggacggactgcagaagaggaacctgtcatcacccatggcttc
accatgacaactgaaatatccttcaaggaagtgatagaagcaattgcggagtgtgcattt
aagacttcaccttttccaattctcctttcgtttgagaaccatgtggattccccaaagcag
caagccaagatggcggagtactgccgactgatctttggggatgcccttctcatggagccc
ctggaaaaatatccactggaatctggagttcctcttccaagccctatggatttaatgtat
aaaattttggtgaaaaataagaagaaatcacacaagtcatcagaaggaagcggcaaaaag
aagctctcagaacaagcctccaacacctacagtgactcctccagcatgtttgagccctca
tccccaggagccggagaagctgatacggaaagtgacgacgacgatgatgatgatgactgt
aaaaaatcttcaatggatgaggggactgctggaagtgaggctatggccacagaagaaatg
tctaatctggtgaactatattcagccagtcaagtttgagtcatttgaaatttcaaaaaaa
agaaataaaagttttgaaatgtcttccttcgtggaaaccaaaggacttgaacaactcacc
aagtctccagtggaatttgtagaatataacaaaatgcagcttagcaggatatatccaaaa
ggaacacgtgtggattcatccaactatatgcctcagctcttctggaatgcaggttgtcag
atggtggcacttaatttccagacaatggacctggctatgcaaataaatatggggatgtat
gaatacaacgggaagagtggctacagattgaagccagagttcatgaggaggcctgacaag
cattttgatccatttactgaaggcatcgtagatgggatagtggcaaacactttgtctgtt
aagattatttcaggtcagtttctttctgataagaaagttgggacttacgtggaagtggat
atgtttggtttgcctgtggatacaaggaggaaggcatttaagaccaaaacatcccaagga
aatgctgtgaatcctgtctgggaagaagaacctattgtgttcaaaaaggtggttcttcct
actctggcctgtttgagaatagcagtttatgaagaaggaggtaaattcattggccaccgt
atcttgccagtgcaagccattcggccaggctatcactatatctgtctaaggaatgaaagg
aaccagcctctgacgctccctgctgtctttgtctacatagaagtgaaagactatgtgcca
gacacatatgcagatgtcatcgaagctttatcaaacccaatccgatatgtgaacctgatg
gaacagagagctaagcaattggctgctttgacactggaagatgaagaagaagtaaagaaa
gaggctgatcctggagaaacaccatcagaggctccaagtgaagcgagaacgactccagca
gaaaatggggtgaatcacactacaaccctgacacccaagccaccctcccaggctctccac
agccagccagctccaggttctgtaaaggcacctgccaaaacagaagatcttattcagagt
gtcttaacagaagtggaagcacagaccatcgaagaactaaagcaacagaaatcgtttgtg
aaacttcaaaagaaacactacaaagaaatgaaagacctggttaagagacaccacaagaaa
accactgaccttatcaaagaacacactaccaagtataatgaaattcagaatgactacttg
agaaggagagcagctttggaaaagtccgccaaaaaggacagtaagaaaaaatcggaaccc
agcagccctgatcatggttcatcaacgattgagcaagacctcgctgccctggatgctgaa
atgacccaaaagttaatagacttgaaggacaaacaacagcagcagctgcttaatcttcgg
caagaacagtattatagtgaaaaataccagaagcgagaacatattaaactgcttattcaa
aagttgacggatgtcgcagaagagtgtcagaacaatcagttaaagaagctcaaagaaatc
tgtgagaaagaaaagaaagaattaaagaagaaaatggataaaaagaggcaggagaagata
acagaagctaaatccaaagacaaaagtcagatggaagaggagaagacagagatgatccgg
tcatatatccaggaagtggtgcagtatatcaagaggctagaagaagcgcaaagtaaacgg
caagaaaaactcgtagagaaacacaaagaaatacgtcagcagatcctggatgaaaagccc
aagctgcaggtggagctggagcaagaataccaagacaaattcaaaagactgcccctcgag
attttggaattcgtgcaggaagccatgaaaggaaagatcagtgaagacagcaatcacggt
tctgcccctctctccctgtcctcagaccctggaaaagtgaaccacaagactccctccagt
gaggagctgggaggagacatcccaggaaaagaatttgatactcctctgtga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101154323
Entry
101154323         CDS       T02442                                 

Gene name
PLCB4
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-4
  KO
K05858  phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00562  Inositol phosphate metabolism
ggo01100  Metabolic pathways
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04062  Chemokine signaling pathway
ggo04070  Phosphatidylinositol signaling system
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04310  Wnt signaling pathway
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04621  NOD-like receptor signaling pathway
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04742  Taste transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04973  Carbohydrate digestion and absorption
ggo05010  Alzheimer disease
ggo05016  Huntington disease
ggo05017  Spinocerebellar ataxia
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05142  Chagas disease
ggo05143  African trypanosomiasis
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05200  Pathways in cancer
Module
ggo_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101154323 (PLCB4)
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101154323 (PLCB4)
   04310 Wnt signaling pathway
    101154323 (PLCB4)
   04371 Apelin signaling pathway
    101154323 (PLCB4)
   04020 Calcium signaling pathway
    101154323 (PLCB4)
   04070 Phosphatidylinositol signaling system
    101154323 (PLCB4)
   04072 Phospholipase D signaling pathway
    101154323 (PLCB4)
   04071 Sphingolipid signaling pathway
    101154323 (PLCB4)
   04022 cGMP-PKG signaling pathway
    101154323 (PLCB4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101154323 (PLCB4)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101154323 (PLCB4)
   04621 NOD-like receptor signaling pathway
    101154323 (PLCB4)
   04062 Chemokine signaling pathway
    101154323 (PLCB4)
  09152 Endocrine system
   04911 Insulin secretion
    101154323 (PLCB4)
   04922 Glucagon signaling pathway
    101154323 (PLCB4)
   04929 GnRH secretion
    101154323 (PLCB4)
   04912 GnRH signaling pathway
    101154323 (PLCB4)
   04915 Estrogen signaling pathway
    101154323 (PLCB4)
   04921 Oxytocin signaling pathway
    101154323 (PLCB4)
   04926 Relaxin signaling pathway
    101154323 (PLCB4)
   04935 Growth hormone synthesis, secretion and action
    101154323 (PLCB4)
   04918 Thyroid hormone synthesis
    101154323 (PLCB4)
   04919 Thyroid hormone signaling pathway
    101154323 (PLCB4)
   04928 Parathyroid hormone synthesis, secretion and action
    101154323 (PLCB4)
   04916 Melanogenesis
    101154323 (PLCB4)
   04924 Renin secretion
    101154323 (PLCB4)
   04925 Aldosterone synthesis and secretion
    101154323 (PLCB4)
   04927 Cortisol synthesis and secretion
    101154323 (PLCB4)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101154323 (PLCB4)
   04270 Vascular smooth muscle contraction
    101154323 (PLCB4)
  09154 Digestive system
   04970 Salivary secretion
    101154323 (PLCB4)
   04971 Gastric acid secretion
    101154323 (PLCB4)
   04972 Pancreatic secretion
    101154323 (PLCB4)
   04973 Carbohydrate digestion and absorption
    101154323 (PLCB4)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101154323 (PLCB4)
  09156 Nervous system
   04724 Glutamatergic synapse
    101154323 (PLCB4)
   04725 Cholinergic synapse
    101154323 (PLCB4)
   04728 Dopaminergic synapse
    101154323 (PLCB4)
   04726 Serotonergic synapse
    101154323 (PLCB4)
   04720 Long-term potentiation
    101154323 (PLCB4)
   04730 Long-term depression
    101154323 (PLCB4)
   04723 Retrograde endocannabinoid signaling
    101154323 (PLCB4)
  09157 Sensory system
   04742 Taste transduction
    101154323 (PLCB4)
   04750 Inflammatory mediator regulation of TRP channels
    101154323 (PLCB4)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101154323 (PLCB4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101154323 (PLCB4)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101154323 (PLCB4)
   05016 Huntington disease
    101154323 (PLCB4)
   05017 Spinocerebellar ataxia
    101154323 (PLCB4)
   05022 Pathways of neurodegeneration - multiple diseases
    101154323 (PLCB4)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101154323 (PLCB4)
   04934 Cushing syndrome
    101154323 (PLCB4)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101154323 (PLCB4)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101154323 (PLCB4)
   05142 Chagas disease
    101154323 (PLCB4)
   05143 African trypanosomiasis
    101154323 (PLCB4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101154323 (PLCB4)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101154323 (PLCB4)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101154323 (PLCB4)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101154323 (PLCB4)
SSDB
Motif
Pfam: PI-PLC-X PH_14 PI-PLC-Y DUF1154 EF-hand_like C2 EF-hand_7 EF-hand_6
Other DBs
NCBI-GeneID: 101154323
NCBI-ProteinID: XP_030860784
Ensembl: ENSGGOG00000008419
LinkDB
Position
20
AA seq 1194 aa
MAKPYEFNWQKEVPSFLQEGAVFDRYEEESFVFEPNCLFKVDEFGFFLTWKSEGKEGQVL
ECSLINSIRSGAIPKDPKILAALEAVGKSENDLEGRIVCVCSGTDLVNISFTYMVAENPE
VTKQWVEGLRSIIHNFRANNVSPMTCLKKHWMKLAFMTNTNGKIPVRSITRTFASGKTEK
VIFQALKELGLPSGKNDEIEPTAFSYEKFYELTQKICPRTDIEDLFKKINGDKTDYLTVD
QLVSFLNEHQRDPRLNEILFPFYDAKRAMQIIEMYEPDEDLKKKGLISSDGFCRYLMSDE
NAPVFLDRLELYQEMDHPLAHYFISSSHNTYLTGRQFGGKSSVEMYRQVLLAGCRCVELD
CWDGKGEDQEPIITHGKAMCTDILFKDVIQAIKETAFVTSEYPVILSFENHCSKYQQYKM
SKYCEDLFGDLLLKQALESHPLEPGRPLPSPNDLKRKILIKNKRLKPEVEKKQLEALRSM
MEAGESASPANILEDDNEEEIESADQEEEAHPEFKFGNELSADDLGHKEAVANSVKKGLV
TVEDEQAWMASYKYVGATTNIHPYLSTMINYAQPVKFQGFHVAEERNIHYNMSSFNESVG
LGYLKTHAIEFVNYNKRQMSRIYPKGGRVDSSNYMPQIFWNAGCQMVSLNYQTPDLAMQL
NQGKFEYNGSCGYLLKPDFMRRPDRTFDPFSETPVDGVIAATCSVQVISGQFLSDKKIGT
YVEVDMYGLPTDTIRKEFRTRMVMNNGLNPVYNEESFVFRKVILPDLAVLRIAVYDDNNK
LIGQRILPLDGLQAGYRHISLRNEGNKPLSLPTIFCNIVLKTYVPDGFGDIVDALSDPKK
FLSITEKRADQMRAMGIETSDIADVPSDTSKNDKKGKANTAKANVTPQSSSELRPTTTAA
LASGVEAKKGIELIPQVRIEDLKQMKAYLKHLKKQQKELNSLKKKHAKEHSTMQKLHCTQ
VDKIVAQYDKEKSTHEKILEKAMKKKGGSNCLEMKKETEIKIQTLTSDHKSKVKEIVAQH
TKEWSEMINTHSAEEQEIRDLHLSQQCELLKKLLINAHEQQTQQLKLSHDRESKEMRAHQ
AKISMENSKAISQDKSIKNKAERERRVRELNSSNTKKFLEERKRLAMKQSKEMDQLKKVQ
LEHLEFLEKQNEQLLKSCHAVSQTQGEGDAADGEIGSRDGPQTSNSSMKLQNAN
NT seq 3585 nt   +upstreamnt  +downstreamnt
atggccaaaccttatgaatttaactggcagaaggaagttccttcctttttgcaagaagga
gcagtttttgacagatacgaagaggaatcctttgtgtttgaacccaactgcctcttcaaa
gtggatgagtttggcttctttctgacatggaaaagtgaaggcaaggaaggacaggtgcta
gaatgctccctcatcaacagtattcggtcgggagccataccaaaggatcccaaaatcttg
gctgctcttgaagctgttggaaaatcagaaaatgatctggaagggcggatagtttgtgtc
tgcagtggcacagatctagtgaacattagttttacctacatggtggctgaaaatccagaa
gtaactaagcaatgggtagaaggcctgagatcaatcatacacaacttcagggccaacaac
gtcagtccaatgacatgcctcaagaaacactggatgaaattggcatttatgaccaacaca
aatggtaaaattccagttaggagtattactagaacatttgcatcggggaaaacagaaaag
gtgatctttcaagcactcaaggagttaggtcttcccagtggaaagaatgatgaaattgag
cccacggcattttcttatgaaaagttctatgaactgacacaaaagatttgtcctcggaca
gatatagaagatcttttcaaaaaaatcaatggagacaaaactgattatttaacggtagac
caattagtgagctttctaaatgaacatcaacgagatcctcgattgaatgaaattttattt
ccattttatgatgccaaaagggcaatgcagatcattgagatgtatgaacctgatgaagat
ttgaagaaaaaaggtcttatatcaagtgatgggttttgcagatatctgatgtcagatgaa
aatgccccagtcttcctagatcgtttagaactttaccaagaaatggaccatcctctggct
cactacttcatcagttcttcccataacacttatctcactggcagacagttcggtgggaag
tcttcggtagaaatgtacagacaggttctcctggctggttgcagatgtgttgaacttgac
tgctgggatggaaaaggtgaagaccaagaaccaataataactcatggaaaagcaatgtgt
acagatatcctttttaaggatgtaattcaagccatcaaggaaactgcatttgtcacatca
gaatatcctgtaattctctcctttgaaaatcactgcagcaaatatcaacagtacaagatg
tccaaatattgcgaagatctatttggggatctcctgttgaaacaagcacttgaatcacat
ccacttgaaccaggcaggcctttgccatcccccaatgacctcaaaagaaaaatactcata
aaaaacaagcggctgaaacctgaagttgaaaaaaaacagctggaagctttgagaagcatg
atggaagctggagaatctgcctccccagcaaacatcttagaggacgataatgaagaggag
atcgaaagtgctgaccaagaggaggaagctcaccccgaattcaaatttggaaatgaactt
tctgctgatgacttgggtcacaaggaagctgttgcaaatagcgtcaagaagggcctggtc
actgtagaagatgagcaggcgtggatggcatcttataaatatgtaggtgctaccactaat
atccatccgtatttgtccacaatgatcaactacgcccagcctgtaaagtttcaaggtttc
catgtggcagaagaacgcaatattcattataacatgtcttcttttaatgaatcagtcggt
cttggctacttgaagacacatgcaattgaatttgtcaattataacaaacggcaaatgagt
cgcatttaccccaagggaggccgagtcgattccagtaattacatgcctcagattttctgg
aacgctggctgccagatggtttcgctgaactatcaaaccccagatttagcgatgcaattg
aatcagggaaaatttgagtataatggatcgtgcgggtaccttctcaaaccagatttcatg
aggcggcctgatcgaacatttgaccccttctctgaaactcctgttgatggtgttattgca
gccacttgctcagtgcaggttatatcaggtcaattcttatcagataagaaaattggcact
tacgtagaggtggatatgtatgggttgcccactgacaccatacgtaaggaattccgaact
cgcatggttatgaataatggactcaatccagtttacaatgaagagtcatttgtatttcgg
aaggtgatcctgccggacctggctgtcttgagaatagctgtgtatgatgataacaacaag
ctgattggccagaggatcctcccgcttgatggcctccaagccggatatcgacacatttcc
cttcgaaatgagggaaataaaccgttatcactgccaacaattttctgcaatattgttctt
aaaacatatgtgcctgatggatttggagatatcgtggatgctttatcagatccaaagaaa
tttctctcaattacagaaaagagagcagaccaaatgagagctatgggcattgaaaccagt
gacatagccgacgtgcccagtgacacttccaaaaatgacaagaaaggaaaggccaacacc
gccaaagcaaatgtgacccctcagagtagctctgagctcagaccaaccaccacggctgcc
ctggcctctggtgtggaagccaagaaaggtattgaacttatccctcaagtaaggatagaa
gacttaaagcagatgaaggcttacttgaagcatttaaagaaacagcagaaggagctaaat
tctttaaagaagaaacatgcaaaggaacacagtaccatgcagaagttacactgcacgcaa
gttgacaaaattgtggcacagtatgacaaagagaagtcgactcatgagaaaatcctagag
aaggcaatgaagaagaaggggggaagtaattgtctcgaaatgaaaaaagaaacagaaatc
aaaattcagacgctgacatcagatcacaaatctaaggtcaaagagattgtagcacagcac
acaaaggaatggtcagaaatgatcaatacccacagtgctgaggagcaagaaatccgagac
ctgcacctcagccagcagtgtgagctgctgaaaaagctactcatcaatgcccacgagcag
caaacccagcagctgaaactgtcccatgacagggaaagcaaggaaatgcgagcacaccag
gctaagatttctatggaaaatagcaaagccatcagccaagataaatctatcaagaataaa
gcagaacgggaaaggcgagtcagggagttaaacagcagcaacactaaaaagtttctggaa
gaaagaaagagacttgccatgaagcagtccaaagaaatggatcagttgaaaaaagtccag
cttgaacatctagaattcctagagaaacagaatgagcagcttttgaaatcctgtcatgca
gtgtcccaaacgcaaggcgaaggagatgcagcagatggtgaaattggaagccgagatgga
ccgcagaccagcaacagtagtatgaaactccaaaatgcaaactga

DBGET integrated database retrieval system