KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101129545Help
Entry
101129545         CDS       T02442                                 

Definition
(RefSeq) uncharacterized LOC101129545
  KO
K11254  histone H4
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo05034  Alcoholism
ggo05203  Viral carcinogenesis
ggo05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:ggo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101129545
  Immune diseases
   05322 Systemic lupus erythematosus
    101129545
  Substance dependence
   05034 Alcoholism
    101129545
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    101129545
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF TAF TFIID-31kDa Bromo_TP PAF
Motif
Other DBs
NCBI-GeneID: 101129545
NCBI-ProteinID: XP_004043428
LinkDB All DBs
Position
6
AA seq 365 aa AA seqDB search
MSGRGKGGKGLGKGGAKCHRKVLSHNIQGITKSTILRLARHGSVKRISGLIYEETRRVFK
VFLENVIWYAVTNTEHAKRKTVTAMAVVYVLKRQGRTLPTRVDHLRSGLFCRFAMARTKQ
TARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKL
PFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQ
LARRIRGERAFAYLVFVLSGLGMSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRL
ARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTL
YGFGG
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgtctggtcggggcaagggcggaaaaggccttgggaaaggcggtgccaagtgccatcgc
aaggtactgagccataacattcagggcattaccaagtccactatcctgcgcttggcccgg
catggcagtgtcaagcgcatctcgggcctcatttatgaggagacccgccgggtgttcaag
gtgttcctggaaaatgtgatctggtacgccgtgaccaacacggagcacgccaagcgcaag
acggtcaccgccatggccgtggtctacgtgctcaaacgccagggacgaaccctgccaacg
cgggtggatcatctgaggtcaggacttttctgtcgttttgccatggctcgtactaaacag
acagctcgcaaatccaccggcggtaaggcgccacgcaagcagctggctaccaaggctgct
cgcaagagcgcgccggctactggcggcgtgaaaaagcctcaccgttaccgcccgggcact
gtggctctgcgcgagatccgccgctaccagaagtcgaccgagctgcttattcggaagctg
ccgttccagcgcctggtgcgagaaatcgcccaagacttcaagaccgatcttcgcttccag
agctctgcggtgatggcgctgcaggaggcttgtgaggcctacttggtagggctctttgag
gacacaaacctttgcgccatccatgccaagcgagtgactattatgcccaaggacatccag
ctcgctcgccgcattcgcggagagagagcttttgcgtacctggtctttgttctcagcgga
ttaggcatgtctggtcgtggcaaaggaggtaaaggtttgggtaaaggaggtgccaagcgt
caccgaaaagtgttgcgggataatatccaaggcatcaccaagccggccattcggcgcctt
gctaggcgtggtggggttaagcgaatctccggtttgatttatgaggagactcgtggcgtt
ctcaaggtgtttctggagaacgtgatccgggacgccgtgacctacacggagcacgccaag
cgcaagactgtcactgccatggatgtggtttacgcgctcaagcgtcaaggacgcaccctg
tacggcttcggcggttaa

DBGET integrated database retrieval system