KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101129671
Entry
101129671         CDS       T02442                                 

Gene name
GNA11
Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04270  Vascular smooth muscle contraction
ggo04540  Gap junction
ggo04725  Cholinergic synapse
ggo04730  Long-term depression
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04925  Aldosterone synthesis and secretion
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo05142  Chagas disease
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101129671 (GNA11)
   04022 cGMP-PKG signaling pathway
    101129671 (GNA11)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101129671 (GNA11)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101129671 (GNA11)
   04929 GnRH secretion
    101129671 (GNA11)
   04912 GnRH signaling pathway
    101129671 (GNA11)
   04935 Growth hormone synthesis, secretion and action
    101129671 (GNA11)
   04928 Parathyroid hormone synthesis, secretion and action
    101129671 (GNA11)
   04925 Aldosterone synthesis and secretion
    101129671 (GNA11)
   04927 Cortisol synthesis and secretion
    101129671 (GNA11)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101129671 (GNA11)
  09156 Nervous system
   04725 Cholinergic synapse
    101129671 (GNA11)
   04730 Long-term depression
    101129671 (GNA11)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101129671 (GNA11)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101129671 (GNA11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101129671 (GNA11)
   05163 Human cytomegalovirus infection
    101129671 (GNA11)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101129671 (GNA11)
   05142 Chagas disease
    101129671 (GNA11)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101129671 (GNA11)
  Exosomal proteins of melanoma cells
   101129671 (GNA11)
GTP-binding proteins [BR:ggo04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    101129671 (GNA11)
SSDB
Motif
Pfam: G-alpha AAA_29
Other DBs
NCBI-GeneID: 101129671
NCBI-ProteinID: XP_030863344
LinkDB
Position
Unknown
AA seq 282 aa
MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWEDPGIQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRYRPGRSRRGGALKGSFARCAGSRLRTQCFGRPRREESE
PSPGSGVRACGALAGRVLEGLAVAPVAGAFSCSASSPWHWPS
NT seq 849 nt   +upstreamnt  +downstreamnt
atgactctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgctcggcacgggcgagagcgggaagagcacgttcatcaagcagatgcgc
atcatccacggcgccggctactcggaggaggacaagcgcggcttcaccaagctcgtctac
cagaacatcttcaccgccatgcaggccatgatccgggccatggagacgctcaagatcctc
tacaagtacgagcagaacaaggccaatgcgctcctgatccgggaggtggacgtggagaag
gtgaccaccttcgagcatcagtacgtcagcgccatcaagaccctgtgggaggacccgggc
atccaggaatgctacgaccgcaggcgcgagtaccagctctccgactccgccaagtactac
ctgaccgacgttgaccgcatcgccaccttgggctacctgcccacccagcaggacgtgctg
cgggtccgcgtgcccaccaccggcatcatcgagtaccctttcgacctggagaacatcatc
ttccggtaccgcccgggccgcagcaggcggggaggggcactgaaaggctcatttgcccgg
tgtgccggctcacgcctgcgcacccagtgctttgggaggccaaggcgggaggaatcagag
ccgtccccgggttctggtgttcgtgcgtgtggggcgctagccggccgtgtcctggagggc
ctcgcggtggctccggttgcgggtgccttctcctgcagcgcaagctcgccctggcactgg
ccctcatga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101149632
Entry
101149632         CDS       T02442                                 

Definition
(RefSeq) guanine nucleotide-binding protein subunit alpha-11
  KO
K04635  guanine nucleotide-binding protein subunit alpha-11
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04270  Vascular smooth muscle contraction
ggo04540  Gap junction
ggo04725  Cholinergic synapse
ggo04730  Long-term depression
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04925  Aldosterone synthesis and secretion
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo05142  Chagas disease
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101149632
   04022 cGMP-PKG signaling pathway
    101149632
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101149632
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101149632
   04929 GnRH secretion
    101149632
   04912 GnRH signaling pathway
    101149632
   04935 Growth hormone synthesis, secretion and action
    101149632
   04928 Parathyroid hormone synthesis, secretion and action
    101149632
   04925 Aldosterone synthesis and secretion
    101149632
   04927 Cortisol synthesis and secretion
    101149632
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101149632
  09156 Nervous system
   04725 Cholinergic synapse
    101149632
   04730 Long-term depression
    101149632
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101149632
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101149632
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101149632
   05163 Human cytomegalovirus infection
    101149632
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101149632
   05142 Chagas disease
    101149632
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101149632
  Exosomal proteins of melanoma cells
   101149632
GTP-binding proteins [BR:ggo04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    101149632
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA AAA_29
Other DBs
NCBI-GeneID: 101149632
NCBI-ProteinID: XP_030863933
LinkDB
Position
2A
AA seq 359 aa
MALESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGAGYSEEDKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEK
VTTFEHQYVSAIKTLWEDPGIQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVL
RVRVPTTGIIEYPFDLENIIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPRFQNSSVILFLNKKDLLEDKILYSHLVDYFPEFDGPQR
DAQAAREFILKMFVDLNPNSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggctctggagtccatgatggcgtgttgcctgagcgatgaggtgaaggagtccaagcgg
atcaacgccgagatcgagaagcagctgcggcgggacaagcgcgacgcccggcgcgagctc
aagctgctgctgctcggcacgggcgagagcgggaagagcacgttcatcaagcagatgcgc
atcatccatggcgccggctactcggaggaggacaagcgcggcttcaccaagctcgtctac
cagaacatcttcaccgccatgcaggccatgatccgagccatggagacgctcaagatcctc
tacaagtacgagcagaacaaggccaatgcgctcctgatccgggaggtggacgtggagaag
gtgaccaccttcgagcatcagtacgtcagcgccatcaagaccctgtgggaggacccgggc
atccaggaatgctacgaccgcaggcgcgagtaccagctctccgactccgccaagtactac
ctgaccgacgttgaccgcatcgccaccttgggctacctgcccacccagcaggacgtgctg
cgggtccgcgtgcccaccaccggcatcatcgagtaccctttcgacctggagaacatcatc
ttccggatggtggatgtggggggccagcggtcagagcggaggaagtggatccactgcttt
gagaacgtgacatccatcatgtttctcgttgccctcagcgaatacgaccaagtcctggtg
gagtcggacaacgagaaccggatggaggagagcaaagccctgttccggaccatcatcacc
tacccccggttccagaactcctccgtcatcctcttcctcaacaagaaggacctgctggag
gacaagatcctgtactcgcacctggtggactacttccccgagttcgacggtccccagcgg
gacgcccaggcggcgcgggagttcatcctgaagatgttcgtggacctgaaccccaacagc
gacaagatcatctactcacacttcacgtgtgccaccgacacggagaacatccgctttgtg
ttcgcggccgtgaaggacaccatcctgcagctcaacctcaaggagtacaacctggtctga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101149651
Entry
101149651         CDS       T02442                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04062  Chemokine signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04371  Apelin signaling pathway
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo05010  Alzheimer disease
ggo05016  Huntington disease
ggo05017  Spinocerebellar ataxia
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05135  Yersinia infection
ggo05142  Chagas disease
ggo05143  African trypanosomiasis
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101149651
   04371 Apelin signaling pathway
    101149651
   04020 Calcium signaling pathway
    101149651
   04071 Sphingolipid signaling pathway
    101149651
   04022 cGMP-PKG signaling pathway
    101149651
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101149651
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101149651
   04062 Chemokine signaling pathway
    101149651
  09152 Endocrine system
   04911 Insulin secretion
    101149651
   04922 Glucagon signaling pathway
    101149651
   04929 GnRH secretion
    101149651
   04912 GnRH signaling pathway
    101149651
   04915 Estrogen signaling pathway
    101149651
   04921 Oxytocin signaling pathway
    101149651
   04935 Growth hormone synthesis, secretion and action
    101149651
   04918 Thyroid hormone synthesis
    101149651
   04928 Parathyroid hormone synthesis, secretion and action
    101149651
   04916 Melanogenesis
    101149651
   04924 Renin secretion
    101149651
   04925 Aldosterone synthesis and secretion
    101149651
   04927 Cortisol synthesis and secretion
    101149651
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101149651
   04270 Vascular smooth muscle contraction
    101149651
  09154 Digestive system
   04970 Salivary secretion
    101149651
   04971 Gastric acid secretion
    101149651
   04972 Pancreatic secretion
    101149651
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101149651
  09156 Nervous system
   04724 Glutamatergic synapse
    101149651
   04725 Cholinergic synapse
    101149651
   04728 Dopaminergic synapse
    101149651
   04726 Serotonergic synapse
    101149651
   04720 Long-term potentiation
    101149651
   04730 Long-term depression
    101149651
   04723 Retrograde endocannabinoid signaling
    101149651
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101149651
  09159 Environmental adaptation
   04713 Circadian entrainment
    101149651
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101149651
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101149651
   05016 Huntington disease
    101149651
   05017 Spinocerebellar ataxia
    101149651
   05022 Pathways of neurodegeneration - multiple diseases
    101149651
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101149651
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101149651
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101149651
   05163 Human cytomegalovirus infection
    101149651
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101149651
   05142 Chagas disease
    101149651
   05143 African trypanosomiasis
    101149651
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101149651
GTP-binding proteins [BR:ggo04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    101149651
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 101149651
NCBI-ProteinID: XP_030870411
LinkDB
Position
9
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagatcgagcggcagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctcgggacaggagagagtggcaagagtacgtttatcaagcagatgaga
atcatccatgggtcaggatactctgatgaagataaaaggggcttcaccaagctggtgtat
cagaacatcttcacggccatgcaggccatgatcagagccatggacacactcaagatccca
tacaagtatgagcacaataaggctcatgcacaattagttcgagaagttgatgtggagaag
gtgtctgcttttgagaatccatatgtagatgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgatagacgacgagaatatcaattatctgactctaccaaatactat
cttaatgacttggaccgcgtagctgaccctgcctacctgcctacgcaacaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gagtcagacaatgagaaccgaatggaggaaagcaaggctctctttagaacaattatcaca
tacccctggttccagaactcctcggttattctgttcttaaacaagaaagatcttctagag
gagaaaatcatgtattcccatctagtcgactacttcccagaatatgatggaccccagaga
gatgcccaggcagcccgagaattcattctgaagatgttcgtggacctgaacccagacagt
gacaaaattatctactcccacttcacgtgcgccacagacaccgagaatatccgctttgtc
tttgctgccgtcaaggacaccatcctccagttgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system