KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101130047Help
Entry
101130047         CDS       T02442                                 

Gene name
POLE3
Definition
(RefSeq) DNA polymerase epsilon subunit 3
  KO
K02326  DNA polymerase epsilon subunit 3 [EC:2.7.7.7]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo03030  DNA replication
ggo03410  Base excision repair
ggo03420  Nucleotide excision repair
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101130047 (POLE3)
   03410 Base excision repair
    101130047 (POLE3)
   03420 Nucleotide excision repair
    101130047 (POLE3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:ggo03032]
    101130047 (POLE3)
   03036 Chromosome and associated proteins [BR:ggo03036]
    101130047 (POLE3)
   03400 DNA repair and recombination proteins [BR:ggo03400]
    101130047 (POLE3)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     101130047 (POLE3)
DNA replication proteins [BR:ggo03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   DNA polymerase epsilon complex
    101130047 (POLE3)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic type
  Chromatin remodeling factors
   CHRAC complex
    101130047 (POLE3)
DNA repair and recombination proteins [BR:ggo03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase epsilon complex
      101130047 (POLE3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CBFD_NFYB_HMF Histone CENP-T_C BUD22 DUF5427 SpoU_methylase TAF DUF4746 Myc_N Pox_Ag35 CDC45 NOA36 DDHD CLN3 Serinc SID-1_RNA_chan
Motif
Other DBs
NCBI-GeneID: 101130047
NCBI-ProteinID: XP_004048524
Ensembl: ENSGGOG00000005370
UniProt: G3QRK2
LinkDB All DBs
Position
9
AA seq 147 aa AA seqDB search
MAERPEDLNLPNAVITRIIKEALPDGVNISKEARSAISRAASVFVLYATSCANNFAMKGK
RKTLNASDVLSAMEEMEFQRFVTPLKEALEAYRREQKGKKEASEQKKKDKDKKTDSEEQD
KSRDEDNDEDEERLEEEEQNEEEEVDN
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaggcccgaggacctaaacctgcccaacgccgtgatcaccaggatcatcaag
gaggcgctcccggacggtgtcaacatctccaaggaggcccggagcgccatctcccgcgcc
gccagcgtcttcgtgctgtacgccacatcctgtgctaacaactttgcaatgaaaggaaag
cggaagacgctgaatgctagtgatgtgctctcagccatggaagagatggagttccagcgg
ttcgttaccccattgaaagaagctctggaagcatataggcgggaacagaaaggcaagaag
gaggcctcagagcaaaagaagaaggacaaagacaaaaaaacagactcggaagagcaagac
aagagcagggatgaggacaatgatgaagacgaagaaaggctggaagaagaagaacagaat
gaagaggaagaagtagacaactga

DBGET integrated database retrieval system