KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101130447
Entry
101130447         CDS       T02442                                 

Gene name
CCND1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04068  FoxO signaling pathway
ggo04110  Cell cycle
ggo04115  p53 signaling pathway
ggo04151  PI3K-Akt signaling pathway
ggo04152  AMPK signaling pathway
ggo04218  Cellular senescence
ggo04310  Wnt signaling pathway
ggo04340  Hedgehog signaling pathway
ggo04371  Apelin signaling pathway
ggo04390  Hippo signaling pathway
ggo04510  Focal adhesion
ggo04530  Tight junction
ggo04630  JAK-STAT signaling pathway
ggo04917  Prolactin signaling pathway
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04934  Cushing syndrome
ggo05160  Hepatitis C
ggo05162  Measles
ggo05163  Human cytomegalovirus infection
ggo05165  Human papillomavirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05200  Pathways in cancer
ggo05203  Viral carcinogenesis
ggo05205  Proteoglycans in cancer
ggo05206  MicroRNAs in cancer
ggo05210  Colorectal cancer
ggo05212  Pancreatic cancer
ggo05213  Endometrial cancer
ggo05214  Glioma
ggo05215  Prostate cancer
ggo05216  Thyroid cancer
ggo05218  Melanoma
ggo05219  Bladder cancer
ggo05220  Chronic myeloid leukemia
ggo05221  Acute myeloid leukemia
ggo05222  Small cell lung cancer
ggo05223  Non-small cell lung cancer
ggo05224  Breast cancer
ggo05225  Hepatocellular carcinoma
ggo05226  Gastric cancer
ggo05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101130447 (CCND1)
   04340 Hedgehog signaling pathway
    101130447 (CCND1)
   04390 Hippo signaling pathway
    101130447 (CCND1)
   04371 Apelin signaling pathway
    101130447 (CCND1)
   04630 JAK-STAT signaling pathway
    101130447 (CCND1)
   04068 FoxO signaling pathway
    101130447 (CCND1)
   04151 PI3K-Akt signaling pathway
    101130447 (CCND1)
   04152 AMPK signaling pathway
    101130447 (CCND1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101130447 (CCND1)
   04115 p53 signaling pathway
    101130447 (CCND1)
   04218 Cellular senescence
    101130447 (CCND1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101130447 (CCND1)
   04530 Tight junction
    101130447 (CCND1)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    101130447 (CCND1)
   04921 Oxytocin signaling pathway
    101130447 (CCND1)
   04919 Thyroid hormone signaling pathway
    101130447 (CCND1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101130447 (CCND1)
   05206 MicroRNAs in cancer
    101130447 (CCND1)
   05205 Proteoglycans in cancer
    101130447 (CCND1)
   05203 Viral carcinogenesis
    101130447 (CCND1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101130447 (CCND1)
   05212 Pancreatic cancer
    101130447 (CCND1)
   05225 Hepatocellular carcinoma
    101130447 (CCND1)
   05226 Gastric cancer
    101130447 (CCND1)
   05214 Glioma
    101130447 (CCND1)
   05216 Thyroid cancer
    101130447 (CCND1)
   05221 Acute myeloid leukemia
    101130447 (CCND1)
   05220 Chronic myeloid leukemia
    101130447 (CCND1)
   05218 Melanoma
    101130447 (CCND1)
   05219 Bladder cancer
    101130447 (CCND1)
   05215 Prostate cancer
    101130447 (CCND1)
   05213 Endometrial cancer
    101130447 (CCND1)
   05224 Breast cancer
    101130447 (CCND1)
   05222 Small cell lung cancer
    101130447 (CCND1)
   05223 Non-small cell lung cancer
    101130447 (CCND1)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101130447 (CCND1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101130447 (CCND1)
   04934 Cushing syndrome
    101130447 (CCND1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101130447 (CCND1)
   05162 Measles
    101130447 (CCND1)
   05160 Hepatitis C
    101130447 (CCND1)
   05163 Human cytomegalovirus infection
    101130447 (CCND1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101130447 (CCND1)
   05169 Epstein-Barr virus infection
    101130447 (CCND1)
   05165 Human papillomavirus infection
    101130447 (CCND1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101130447 (CCND1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 101130447
NCBI-ProteinID: XP_030871781
LinkDB
Position
11
AA seq 295 aa
MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI
NT seq 888 nt   +upstreamnt  +downstreamnt
atggaacaccagctcctgtgctgcgaagtggaaaccatccgccgcgcgtaccccgatgcc
aacctcctcaacgaccgggtgctgcgggccatgctgaaggcggaggagacctgcgcgccc
tcggtgtcctacttcaaatgtgtgcagaaggaggtcctgccgtccatgcggaagatcgtc
gccacctggatgctggaggtctgcgaggaacagaagtgcgaggaggaggtcttcccgctg
gccatgaactacctggaccgcttcctgtcgctggagcccgtgaaaaagagccgccttcag
ctgctgggggccacttgcatgttcgtggcctctaagatgaaggagaccatccccctgacg
gccgagaagctgtgcatctacaccgacaactccatccggcccgaggagctgctgcaaatg
gagctgctcctggtgaacaagctcaagtggaacctggccgccatgaccccgcacgatttc
attgaacacttcctctccaaaatgccagaggcggaggagaacaaacagatcatccgcaaa
cacgcgcagaccttcgttgccctctgtgccacagatgtgaagttcatttccaatccgccc
tccatggtggcagcggggagcgtggtggccgcagtgcaaggcctgaacctgaggagcccc
aacaacttcctgtcctactaccgcctcacacgcttcctctccagagtgatcaagtgtgac
ccggactgcctccgggcctgccaggagcagatcgaagccctgctggagtcaagcctgcgc
caggcccagcagaacatggaccccaaggccgccgaggaggaggaagaggaggaggaggag
gtggacctggcttgcacacccaccgacgtgcgggacgtggacatctga

DBGET integrated database retrieval system