KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101130520Help
Entry
101130520         CDS       T02442                                 

Gene name
WBSCR17
Definition
(RefSeq) Williams-Beuren syndrome chromosome region 17
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00512  Mucin type O-glycan biosynthesis
ggo01100  Metabolic pathways
Module
ggo_M00056  O-glycan biosynthesis, mucin type core
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    101130520 (WBSCR17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ggo01003]
    101130520 (WBSCR17)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     101130520 (WBSCR17)
Glycosyltransferases [BR:ggo01003]
 O-Glycan biosynthesis
  Mucin-type
   101130520 (WBSCR17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin RicinB_lectin_2 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 101130520
NCBI-ProteinID: XP_004045583
Ensembl: ENSGGOG00000005815
UniProt: G3QSQ1
LinkDB All DBs
Position
7
AA seq 598 aa AA seqDB search
MASLRRVKVLLVLNLIAVAGFVLFLAKCRPIAVRSGDAFHEIRPRAEVANLSAHSASPIQ
DAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGY
NSYLSEKISLDRSIPDYRPTKCKELKYSKDLPQISIIFIFVNEALSVILRSVHSAVNHTP
THLLKEIILVDDNSDEEELKVPLEEYVHKRYPGLVKVVRNQKREGLIRARIEGWKVATGQ
VTGFFDAHVEFTAGWAEPVLSRIQENRKRVILPSIDNIKQDNFEVQRYENSAHGYSWELW
CMYISPPKDWWDAGDPSLPIRTPAMIGCSFVVNRKFFGEIGLLDPGMDVYGGENIELGIK
VWLCGGSMEVLPCSRVAHIERKKKPYNSNIGFYTKRNALRVAEVWMDDYKSHVYIAWNLP
LENPGIDIGDVSERRALRKSLKCKNFQWYLDHVYPEMRRYNNTVAYGELRNNKAKDVCLD
QGPLENHTAILYPCHGWGPQLARYTKEGFLHLGALGTTTLLPDTRCLVDNSKSRLPQLLD
CDKVKSSLYKRWNFIQNGAIMNKGTGRCLEVENRGLAGIDLILRSCTGQRWTIKNSIK
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atggcttcactgagaagagtcaaagtgctgttggtgttgaacttgatcgcggtagccggc
ttcgtgctcttcctggccaagtgccggcccatcgcggtgcgcagcggagacgccttccac
gagatccggccgcgcgccgaggtggccaacctcagcgcgcacagcgccagccccatccag
gatgcggtcctgaagcgcctgtcgctgctggaggacatcgtgtaccggcagctgaatggc
ttatccaaatcccttgggctcattgaaggttatggtgggcggggtaaagggggccttccg
gctactctttccccggctgaagaagaaaaggctaagggaccccatgagaagtatggctac
aattcctacctcagtgaaaaaatttcactggaccgttccattccggattatcgtcccacc
aagtgtaaggagctcaagtactccaaggacctgccccagatatccatcatattcatcttc
gtgaacgaggccctgtcggtgatcctgcggtcagtgcacagtgccgtcaatcacacgccc
acacacctgctgaaggaaatcattctggtggatgacaacagtgacgaagaggagctgaag
gtccccctggaggagtatgtccacaaacgctaccccgggctggtgaaggtggtgagaaat
cagaagagggaaggcctgatccgcgctcgcattgagggctggaaggtggccaccgggcag
gtcactggcttctttgatgcccacgtggaattcactgctggctgggctgagccggttcta
tcccgcatccaggaaaaccggaagcgtgtgatcctcccctccattgacaacatcaaacag
gacaactttgaggtgcagcggtatgagaactcggcccacgggtacagctgggagctgtgg
tgcatgtacatcagccccccaaaagactggtgggacgccggagacccttctctccccatc
aggaccccagccatgataggctgctcgttcgtggtcaacaggaagttctttggtgaaatt
ggtcttctggatcctggcatggatgtatacggaggagaaaatattgaactgggaatcaag
gtatggctctgtgggggcagcatggaggtccttccttgctcacgggtggcccacattgag
cggaagaagaagccatataatagcaacattggcttctacaccaagaggaatgctcttcgc
gttgctgaggtctggatggacgattacaagtctcatgtgtacatagcgtggaacctgcca
ctggagaatccgggaattgacatcggtgatgtctccgaaagaagagcattaaggaaaagt
ttaaagtgtaagaatttccagtggtacctggaccatgtttacccagaaatgagaagatac
aataataccgttgcttacggggagcttcgcaacaacaaggcaaaagacgtctgcttggac
caggggccgctggagaaccacacagcaatattgtatccgtgccatggctggggaccacag
cttgcccgctacaccaaggaaggcttcctgcacttgggtgccctggggaccaccacactc
ctccctgacacccgctgcctggtggacaactccaagagtcggctgccccagctcctggac
tgcgacaaggtcaagagcagcctgtacaagcgctggaacttcatccagaatggagccatc
atgaacaagggcacgggacgctgcctggaggtggagaaccgcggcctggctggcatcgac
ctcatcctccgcagctgcacaggtcagaggtggaccattaagaactccatcaagtag

DBGET integrated database retrieval system