KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101131000Help
Entry
101131000         CDS       T02442                                 

Gene name
MGAM2
Definition
(RefSeq) maltase-glucoamylase 2 (putative)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00052  Galactose metabolism
ggo00500  Starch and sucrose metabolism
ggo01100  Metabolic pathways
ggo04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    101131000 (MGAM2)
   00500 Starch and sucrose metabolism
    101131000 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101131000 (MGAM2)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     101131000 (MGAM2)
    3.2.1.20  alpha-glucosidase
     101131000 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 101131000
NCBI-ProteinID: XP_018886044
Ensembl: ENSGGOG00000010479
LinkDB All DBs
Position
7
AA seq 2823 aa AA seqDB search
MWIDMNEPSSFVNGAVSPGCGDASLNHPPYMPHLESRDRGLSSKTLCMESEQILPDGSPV
QHYNVHNLYGWSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWAGHWLGDNTAAWDQLKK
SIIGMMEFSLFGISYTGADICGFFEDAEYEMCVRWMQLGAFYPFSRNHNTIGTRRQDPVS
WDAAFVNISRTVLQTRYTLLPYLYTLMHKAHTEGVTVVRPLLHEFVSDQVTWDIDSQFLL
GPAFLVSPVLERNARNVTAYFPRARWYDYYTGVDINARGEWKTLPAPLDHINLHVRGGYI
LPWQEPALNTHLSRQKFMGFKIALDDEGTAGGWLFWDDGQSIDTYGKGLYYLASFSASQN
TMQSHIIFNNYITGTNPLKLGYIEIWGVGSVPITSVSISVSGMVITPSFNNDRTTQMARK
LSVLEVLLIIFCLIVVTIDILLLLLVLEETSDTSFTPECPEIPQSERIDCTPDQEVTEVR
EIRSLLVAYRVLLKRNEYVKLDTSIGPLQFAQQYLQLSFRLPSANVYGLGEHVHQQYRHN
MTWKTWPIFTRDATPTEGMINLYGAHTFFLCLEDASGSSFGVFLMNSNAMEVTLQPAPAI
TYRTIGGILDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRDYGDINKLKEVV
SRNRLAEIPYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHDNGQKYLIIMNPGISK
NSNYEPYNNGSLKRVWILGNNGFAVGEGYPGPTVFPDYTNPVCTEWWTDQVAKFHDHLEF
DGVWIEMNEVSSLLQASNNQCESNNLNFPPFLPRVLDHLLFARTLCMDTEFHGGLHYDIH
SLYGHSMARTTNLALETIFMNNRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPTI
LEFNLFGIPMVGANICGYNNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGVDS
LLLKSSRHYLNIRYTLLPYLYTLFYRAHTRGETVARPLVHEFYQDSATWDVHEQFLWGPG
LLITPVLYEGVDEVKAYIPDAIWYDYETGVAIPWRKQLVNMLLPGDKIGLHLRGGYIFPT
QKPNTTTEASRRNSLGLMIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLQ
AKIINNNYMDTDNLMFTDITILGMDKQPANFIVLLNNVATSSPSVVYNASTKVVTITDLQ
GLVLGQEFSIRWNLPVSDLEKFNCYPDNPTASEESCRQRGCLWEDTSTPGVPTCYYDTIP
NYVASDIQYLNTSITADLSLLMAPESAAAAASDSLSAKISFLHLNVIYHTATMLQVKIYD
PTNKRYEVPVPLNTPPQPVGDPENRLYDVRIQNNPFGIQIQRKNSSAVIWDSQLPGFTFN
DMFLSISTRLPSQYIYGFGETEHTTFRRNMNWNTWGMFARDEPPAYKKNSYGVHPYYMAL
EEDGSAHGVLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRP
AMIPYWALGFHLSRYGYQNDAEISSLYDAMVAAQVPYDVQHVDIDYMNRKLDFTLSANFQ
NLSLLIEQMKKNGMRFILVLDPAISGNETQYLPFIRGQENNVFIKWPDTNDIVWGKVWPD
LPNVIVDGSLDHETQVKLYRAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGL
WIDMNEPSNFVDGSVRGCSNEMLNNPPYMPYLESRDKGLSSKTLCMESQQILPDSSPVEH
YNVHNLYGWSQTRPTYEAVQEVTGQRGVIITRSTFPSSGRWGGHRLGNNTAAWDQLGKSI
IGMMEFSLFGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWN
STFEMLSRKVLETRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDHQFMLGP
AILISPVLETSTFEISAYFPRARWYDYSTGTSSTSTGQRKILKAPLDHINLHVRGGYILP
WQEPAMNTHSSRQNFMGLIVALDDNGTAEGQVFWDDGQSIDTYENGNYFLANFIAAQNIL
QIQTIHNKYLSDSNPLKVGYIRIWGVNTYVTQVSFTYDNQQFMETNFKSEPYNQILTIQL
TDRTINLEKLTEVTWIDGGPVLPTPTKTSTIPMSSHPSPSTTNATSSETITSSASANTTT
GTTDTVPITTTSFPSTTSVTTNTTVPDTTSPFPTSTTNASTNATVPITTTPFPTSTIGVT
TNATVPNTTAPFPTNTTTASTNATVPITTTCFATSTIGVTTNATVPDTTAPFPTNTTTAS
TNATIPITTTPFATSTIGVTTSTTVPDTTAPFPTSTTSASTNATPVPITTTLFATSAIGV
TTGTTVPDTTAPFPTSTTGASTSATVPITTTPSPTNTADANTSNTVPNTTMPSPTSSTTV
STIATIPISVTPSLTSTADATISTTVLIATTSSLTGTTDVSTSTTINNISTLVQTNTTNA
STSTNVANITATSHTGTDDTVPNNTVPVTAIPSLANTGVDTTSNSFSIMTTSFSESTNAM
NTAVIMATTSPTSTDVASTNNDASMTNFLLATMSAGNTTSNSISITTTSFANSVPFVTTP
SPSTDATTTSNNTIPGMTTYYQTSPTIPTHTLTSIPSSITSILSVFPTSNTFTTDKITNF
TTPTNANTIIFNTLDTKSTMVIDATVTTTSTKDNTMSPDTTVTSIDKFTTHITQFATPHS
ATTTTLALSHTSLAPTNLSNLGTMDITDADNSSSVTGNTTHISVSNLTTASDTITATGLD
SQTPHMVTNSVATYLPITATSATTDITNITKYALNTTTPDSTVHISATAPTYIANAINAT
QVP
NT seq 8472 nt NT seq  +upstreamnt  +downstreamnt
atgtggattgatatgaatgaaccatcaagcttcgtgaatggggcagtttctccaggctgc
ggggacgcctctctgaaccaccctccctacatgccacatttggagtccagggacaggggc
ctgagcagcaagaccctgtgcatggagagtgagcagatcctcccagacggctccccggtg
cagcactacaacgtgcacaacctgtacgggtggtcccagaccagacccacatacgaagcc
gtgcaggaggtgacaggacagcgaggggtcgtcatcacccgctccacatttccctcttct
ggccgctgggcaggacattggctgggagacaacacagccgcgtgggatcagctgaagaaa
tctatcattggcatgatggagttcagcctcttcggcatatcctatacgggagcagatatc
tgtgggttctttgaagatgctgaatatgagatgtgtgttcgctggatgcagctgggggcc
ttttatcccttctcaagaaaccacaacaccattgggaccaggagacaagaccctgtgtcc
tgggatgctgcttttgtgaatatttccagaactgtcctgcagaccagatacaccctgttg
ccatatctgtataccttgatgcataaggcccacacggagggcgtcactgttgtgcggcct
ctgctccatgagtttgtgtcagaccaggtgacatgggacatagacagtcagttcctgctg
ggcccagccttcctggtcagccctgtcctggagcgcaatgccagaaatgtcactgcatat
ttccctagagcccgttggtacgattactacacgggtgtggatattaacgcaagaggagag
tggaagaccttgccagccccgcttgaccacattaatcttcatgtccgtgggggctacatc
ctgccctggcaagagcctgcattgaacacccacttaagccgccagaaattcatgggcttc
aaaattgccttggatgatgaaggaactgctgggggctggctcttctgggatgatgggcaa
agcattgatacctatgggaaaggactctattacttggccagcttttctgccagccagaat
acgatgcaaagccatataattttcaacaattacatcactggtacaaatcctttgaaactg
ggctacattgaaatctggggagtgggcagtgtccccattaccagtgtcagcatctctgtg
agtggcatggtcataacaccgtccttcaacaatgaccgcacgacacagatggcgaggaag
ctcagtgtattggaagtccttctgatcatcttctgcttaattgtggtgaccatagatatc
ctcttgctgcttcttgtgttggaggaaacttcagatacttcatttactccagagtgccca
gagattccccagtcggaaaggatagactgcacacctgaccaggaggtgaccgaggtcaga
gaaataaggtcccttttggtggcctacagggtgttattgaaaagaaatgaatatgtgaag
ttggacacgagcatcgggcccctccagtttgcccagcagtacctgcaactgtctttccga
ctgcccagtgccaatgtgtatgggctgggagagcatgtgcaccagcagtaccgccacaat
atgacctggaagacttggcccatcttcacccgggacgctacccccaccgagggcatgatt
aatctgtatggagctcatacattcttcttgtgccttgaagatgccagtggctcctctttt
ggagtatttctgatgaacagtaatgccatggaggttacccttcagccagctcctgcaatc
acttatcgcacgattggaggcattcttgacttttatgtattcctaggaaacactccagaa
caagtggttcaggaatacttggagcttgttggacggccattcttgcctccctattggagt
cttgggttccagcttagtcgcagggattatggtgacatcaataaattgaaagaagttgta
agccgaaatcgtttagctgagataccatatgatgtccagtattctgacatagactacatg
gatggaaagaaggatttcactgttgatgaagtcgcttactctggtctcccagattttgtc
aaggagttacatgacaatggacagaaatatcttattattatgaatcctggcatctccaaa
aactctaactacgagccctataataatggaagcctaaagagagtgtggatcttggggaac
aatggctttgctgttggggagggatatccgggaccaacagtctttcccgattataccaat
ccagtatgcactgagtggtggacagatcaggtcgctaaatttcatgatcatctggagttt
gatggagtgtggattgaaatgaatgaagtatctagcttactccaagcttctaataaccag
tgtgaatccaacaacttgaactttcctccttttcttcctagagttctggatcacttactt
tttgcaagaactctctgcatggacacggagtttcatgggggccttcattatgacatccac
agcttgtatggccactccatggcaagaaccacaaacttagccctggagaccatcttcatg
aataataggagcttcatcttatcccgttctacgtttgctggatctggcaaatttgctgct
cattggctgggggacaatgcggccacatgggatgacctccgatggtctatccccactatc
cttgagttcaacctgtttggcatccccatggtaggtgccaacatctgtggttataacaac
aatgtcacagaggagctctgcagaaggtggatgcagcttggagcattttatccactacca
aggaatcacaatgggcctggattcagggaccaggatcctgctgcctttggtgttgattcc
ctgctgctgaaatcctccagacattatctgaacatccgctacaccttgctgccctatctc
tatacccttttctaccgtgctcacacccggggagagacggtagcaaggccccttgtacat
gagttctaccaggactcagccacgtgggatgtgcatgagcagttcttatggggacctgga
ctcctcatcacgcctgttttatatgaaggtgtggacgaagtgaaagcatacatacctgat
gccatctggtatgactatgagacaggagtggccatcccatggaggaaacagttggtgaat
atgcttctcccaggcgataagataggacttcatctgcgagggggctacatatttcccact
cagaagccaaacacaaccacagaagccagccggaggaattccctgggactcatgatcgcc
ttggactataagagagaagcaaagggggagctgtactgggatgacggtgtatctaaagat
gctgtgactgaaaagaagtatattctatatgatttctctgttacctctaaccatctacaa
gcaaagattataaataataattatatggacactgacaacctcatgtttacagatatcaca
atcttgggaatggacaaacagccagctaattttatcgtcctactgaataatgttgccacc
tccagtccaagcgttgtctacaatgcttccacaaaggtggtaaccatcactgatctccaa
ggactggtactgggacaagaattctctattaggtggaatcttcctgtcagtgatctggag
aagttcaactgctacccagacaatccaacagcctctgaggagagttgtaggcagcggggg
tgtctttgggaggacacatctactcctggagtgcccacctgttactatgacactatccct
aattatgttgctagtgacattcagtacctgaacaccagcatcactgcagacctttccctc
ctgatggcccctgagtcagctgctgctgccgcctctgattctctctctgcaaagatcagc
ttcctccacctgaacgtgatctatcacacagcaaccatgctgcaggtcaagatctatgac
cccactaataaaaggtatgaggttccagtaccactcaacacccctccccaaccagttggt
gaccctgaaaaccgtctgtatgatgtcaggattcagaacaatccttttggaatccagatt
caacgcaaaaactccagtgctgtgatctgggattctcaactccctggcttcaccttcaat
gacatgtttctctccatttctacacgtctgccatctcagtacatctatggctttggggaa
actgagcacacgactttcagaagaaacatgaactggaacacatggggaatgtttgctcgt
gatgagccacctgcgtacaagaagaattcctatggtgtccacccttactacatggcactg
gaggaggatggtagtgcccatggagtgctcctgctaaatagcaatgccatggatgtgaca
ttacagcccactcctgctctgacataccgcaccacaggagggattttggacttctacatt
gttttggggccaacccctgaacttgtaactcagcaatacacagagttgattggtcggcca
gcaatgattccatactgggccttgggattccatctgagtcgctatggataccagaatgat
gctgaaatatccagtttgtatgatgcaatggtggcagcccaggttccctatgacgtccag
catgtagacatcgattacatgaaccggaagctggatttcaccctcagtgccaactttcaa
aatctcagtcttctgattgagcaaatgaagaaaaatggcatgagatttattctcgttttg
gacccagccatttctggcaatgagacacagtatcttccattcattagaggacaggaaaat
aacgtgttcatcaaatggcctgacaccaatgacattgtctggggaaaggtttggccagat
ctgcctaatgtaattgtagatggatcccttgaccatgaaactcaggttaagctttacagg
gcctacgttgcctttcctgacttctttcgtaatagcacagctgcgtggtggaagaaagag
atagaagagctctatgcaaaccctcgagagccagagaagagcttgaagtttgatggactg
tggattgatatgaatgagccatcaaattttgtggatggatctgtcaggggctgcagcaat
gaaatgctaaataacccaccctatatgccatatttggaatctagggacaagggcctgagc
agcaagactctgtgcatggagagtcagcagatcctgccagacagctcccccgtggagcac
tacaacgtgcacaacctgtacgggtggtcccagaccagacccacatacgaagctgtgcag
gaggtgacaggacagcgaggggtcatcatcacccgctccacatttccctcttctggacgc
tggggaggacaccggttgggaaacaacacagctgcatgggaccagctggggaaatctatc
attggcatgatggagttcagtctctttggaataccttatacaggagcagatatctgtggg
ttctttggagatgctgaatatgagatgtgtgttcgctggatgcaactgggggcattttat
ccattttccagaaaccacaacaacatcgggacaaggagacaagatcctgtggcctggaat
tcaacctttgagatgttgtccagaaaagtcctagagaccagatataccctgcttccttat
ctctatactctgatgcataaagctcacgttgagggcagcacagttgtccggccccttctc
catgagtttacggatgacaggacaacatgggatatagaccatcagttcatgttgggccct
gctatcttaatcagccctgtgttggaaactagcacatttgagatctctgcttattttccg
agagcccgttggtatgactatagcacgggaactagcagcacatcaacaggtcagaggaaa
atcctgaaggctccccttgaccacatcaaccttcatgtcagaggaggctacatcctgccc
tggcaagagcctgcaatgaacactcactccagtcgacaaaattttatgggattgattgtt
gctttggatgacaatgggacagctgaaggccaggtgttctgggatgatggacaaagcatt
gatacttatgaaaatggaaattattttttggcaaactttatagcagctcagaacatcctg
caaatccagaccatacacaataagtatttgagtgactcgaatccactaaaagttgggtat
attagaatctggggtgtgaatacctatgtgacacaagtcagtttcacctatgacaaccag
caatttatggagacaaatttcaagagtgaaccttataatcagatactaactattcaattg
actgacaggactatcaacctggaaaagttaactgaggttacttggattgatggtggtcct
gtacttcctactccaactaagacaagtaccatcccaatgagttctcatccttctccatct
actaccaatgccaccagttctgagacaatcaccagttctgccagtgcaaatactaccact
ggcactactgatactgttcctatcacaaccacatctttcccaagtactactagtgttaca
actaatactactgttcctgatacaacttctcctttccctacaagtactactaatgctagc
actaatgctactgttcctatcacaaccacacctttcccaacaagtactattggtgttaca
actaatgctactgttcccaatacaactgcccctttcccaacaaatactactactgctagc
actaatgctactgttcctatcacaaccacatgttttgcaacaagtactattggtgttaca
actaatgctactgttcccgatacaactgcccctttcccaacaaatactactactgctagc
actaatgctactattcctatcacaaccacaccttttgcaacaagtactattggtgttaca
actagtactactgttcctgatacaactgctcctttccctacaagtactactagtgctagc
actaatgctacccctgttcctatcacaaccacactttttgcaacaagtgctattggtgtt
acaactggtactactgttcctgatacaactgctcctttccctacaagtactactggtgct
agcactagtgctactgttccaattacaaccacaccttcccctacaaatactgctgatgct
aacactagtaatactgttcctaataccactatgccttctcctacaagtagtactactgtg
agtactattgctaccattcccatttcagtgactccttctctgacaagtactgctgatgcc
accattagtactactgtacttattgccactacttcttctctaacaggtactactgatgtt
agcactagtactactattaataatataagtactcttgttcaaacaaatactactaatgct
agcactagtactaatgttgctaatataactgctacctctcatacaggtactgatgatact
gttcctaataatactgttccagttacagctattccttctcttgcaaatactggtgttgac
actactagcaacagtttttccattatgaccacttctttctctgaaagtactaatgctatg
aacactgctgttattatggcaactacttctcctacaagtactgatgttgctagcacaaat
aatgatgcttctatgacaaattttcttttagctacaatgtctgctggtaatacaactagt
aatagtatttccataacaactacttcttttgctaatagtgttccttttgtgactactcct
tctccaagtactgatgctactactacaagtaataatactattcctggcatgactacttat
taccagacttctcctaccattcctacccatactcttacttctattcctagctctattact
tctattttgagcgtgtttccaacaagtaatacattcactactgataaaattactaatttt
actacccctacaaatgcaaacaccattattttcaacactcttgatacaaaaagtaccatg
gtaatagatgctacggtcactactaccagcaccaaagataataccatgagtccagataca
acagttacttccatagacaaattcaccacacacatcacacagttcgctactccccattct
gctactactacaacactggccttaagccacacctcattagctcctacaaatctttctaat
ctaggcaccatggatattactgatgcagataactccagcagtgttacaggtaacacgaca
cacatttctgtttcaaatctcacaacagcctcagacacaataacagccactggtctagat
tcacaaactccccatatggtaacaaattctgtggctacttatttacctattactgcaact
agtgctaccacagatattacaaatattacaaaatatgctttaaatactaccactcctgat
agtacagtacatatctctgctactgcacctacttatattgcaaatgccataaatgctact
caagttccatga

DBGET integrated database retrieval system