KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101131029Help
Entry
101131029         CDS       T02442                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00010  Glycolysis / Gluconeogenesis
ggo00051  Fructose and mannose metabolism
ggo00052  Galactose metabolism
ggo00500  Starch and sucrose metabolism
ggo00520  Amino sugar and nucleotide sugar metabolism
ggo00524  Neomycin, kanamycin and gentamicin biosynthesis
ggo01100  Metabolic pathways
ggo01200  Carbon metabolism
ggo04066  HIF-1 signaling pathway
ggo04910  Insulin signaling pathway
ggo04930  Type II diabetes mellitus
ggo04973  Carbohydrate digestion and absorption
ggo05230  Central carbon metabolism in cancer
Module
ggo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ggo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101131029 (HK1)
   00051 Fructose and mannose metabolism
    101131029 (HK1)
   00052 Galactose metabolism
    101131029 (HK1)
   00500 Starch and sucrose metabolism
    101131029 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    101131029 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    101131029 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    101131029 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101131029 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101131029 (HK1)
 09160 Human Diseases
  09161 Cancers
   05230 Central carbon metabolism in cancer
    101131029 (HK1)
  09166 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101131029 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101131029 (HK1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     101131029 (HK1)
Membrane trafficking [BR:ggo04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    101131029 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD
Motif
Other DBs
NCBI-GeneID: 101131029
NCBI-ProteinID: XP_018890476
UniProt: G3RIM9
LinkDB All DBs
Position
10
AA seq 921 aa AA seqDB search
MGQICQRESATAAEKPKLHLLAESEIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFN
PTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPE
NIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFK
ASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQHCEVGLIIGTGTNA
CYMEELRHIDLVEGDEGRMCINTEWGAFGDDGSLEDIRTEFDREIDRGSLNPGKQLFEKM
VSGMYLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEIL
TRLGVEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILNRLRDNKGTPRLRTTVGVDGSL
YKTHPQYSRRFHKTLRRLVPDSDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAH
FHLTKDMLLEVKKRMRAEMELGLRKQTHNNAAVKMLPSFVRRTPDGTENGDFLALDLGGT
NFRVLLVKIRSGKKRTVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPRM
PLGFTFSFPCQQTSLDAGILITWTKGFKATDCVGHDVVTLLRDAIKRREEFDLDVVAVVN
DTVGTMMTCAYEEPTCEVGLIVGTGSNACYMEEMKNVEMVEGDQGQMCINMEWGAFGDNG
CLDDIRTHYDRLVDEYSLNAGKQRYEKMISGMYLGEIVRNILIDFTKKGFLFRGQISEPL
KTRGIFETKFLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSRRAAQLCGA
GMAAVVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDG
SGKGAALITAVGVRLRTEASS
NT seq 2766 nt NT seq  +upstreamnt  +downstreamnt
atggggcagatctgccagcgagaatcggctacagcagctgaaaaaccaaaacttcatcta
cttgctgaaagtgagattgacaagtatctctatgccatgcggctctccgatgaaactctc
atagatatcatgactcgcttcaggaaggagatgaagaatggcctctcccgggattttaat
ccaacagccacagtcaagatgttgccaacattcgtaaggtccattcctgatggctctgaa
aagggagatttcattgccttggatcttggtgggtcttcctttcgaattctgcgggtgcaa
gtgaatcatgagaaaaaccagaatgttcacatggagtccgaggtttatgacaccccagag
aacatcgtgcacggcagtggaagccagctttttgatcatgttgctgagtgcctgggagat
ttcatggagaaaaggaagatcaaggacaagaagttacctgtgggattcacgttttctttt
ccttgccaacaatccaaaatagatgaggccatcctgatcacctggacaaagcgatttaaa
gcgagcggagtggaaggagcagatgtggtcaagctgcttaacaaagccatcaaaaagcga
ggggactatgatgccaacatcgtagctgtggtgaatgacacagtgggcaccatgatgacc
tgtggctatgacgaccagcactgcgaagtcggcctgatcatcggcactggcaccaatgct
tgctatatggaggaactgaggcacattgatctggtggaaggagacgaggggaggatgtgt
atcaatacagaatggggagcctttggagacgatggatcattagaagacatccggacagag
tttgacagggagatagaccggggatccctcaaccctggaaaacagctgtttgagaagatg
gtcagtggcatgtacttgggagagctggttcgactgatcctagtcaagatggccaaggag
ggcctcttatttgaaggacggatcaccccggagctgctcaccagagggaagtttaacacc
agtgatgtgtcagccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctg
acccgcctgggagtggaaccgtccgatgatgactgtgtctcagtccaacacgtttgcacc
attgtctcatttcgctcagccaacctggtggctgccacgctgggcgccatcttgaaccgc
ctgcgtgataacaagggcacacccaggctgcggaccacggttggtgtcgacggatctctt
tacaagacgcacccacagtattcccggcgtttccacaagactctgaggcgcttggtgcca
gactccgatgtgcgcttcctcctctcggagagtggcagcggcaagggggctgccatggtg
acggcggtggcctaccgcttggctgagcagcaccggcagatagaggagaccctggctcat
ttccacctcaccaaggacatgctgctggaggtgaagaagaggatgcgggccgagatggag
ctggggctgaggaagcagacgcacaacaatgccgcggttaagatgctgccctcctttgtc
cggagaactcccgacgggactgagaatggtgacttcttggccctggatcttggaggaacc
aatttccgtgtgctgctggtgaaaatccgtagtgggaaaaagagaacggtggaaatgcac
aacaagatctacgccattcctattgaaatcatgcagggcactggggaagagctgtttgat
cacattgtctcctgcatctctgacttcttggactacatggggatcaaaggccctaggatg
cctctgggcttcacgttctcatttccctgccagcagacgagtctggacgcgggaatcttg
atcacgtggacaaagggttttaaggcaacagactgcgtgggccacgatgtagtcacctta
ctaagggatgcgataaaaaggagagaggaatttgacctggacgtggtggctgtggtcaac
gacacagtgggcaccatgatgacttgtgcttatgaggagcccacctgtgaggttggactc
attgttgggaccggcagcaatgcctgctacatggaggagatgaagaacgtggagatggtg
gagggggaccaggggcagatgtgcatcaacatggagtggggggcctttggggacaacggg
tgtctggatgatatcaggacacactacgacagactggtggacgaatattccctaaacgct
gggaaacaaaggtatgagaagatgatcagtggtatgtacctgggtgaaatcgtccgcaac
atcttaatcgacttcaccaagaagggattcctcttccgagggcagatctctgagccgctg
aagacccggggcatctttgagaccaagtttctctctcagatcgagagtgaccgattagca
ctgctccaggtccgggctatcctccagcagctgggtctgaatagcacctgcgatgacagt
atcctcgtcaagacagtgtgcggggtggtgtccaggagggccgcgcagctgtgtggcgca
ggcatggctgcagtggtggataagatccgcgagaacagaggactggaccgtctgaatgtg
actgtgggagtggacgggacactctacaagcttcatccacacttctccagaatcatgcac
cagacggtgaaggaactgtcaccaaaatgtaacgtgtccttcctcctgtctgaggatggc
agcggcaagggggccgccctcatcacggccgtgggcgtgcggttacgcacagaggcaagc
agctaa

DBGET integrated database retrieval system