KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101131537Help
Entry
101131537         CDS       T02442                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00500  Starch and sucrose metabolism
ggo01100  Metabolic pathways
ggo04151  PI3K-Akt signaling pathway
ggo04152  AMPK signaling pathway
ggo04910  Insulin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04931  Insulin resistance
Module
ggo_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    101131537 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101131537 (GYS2)
   04152 AMPK signaling pathway
    101131537 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101131537 (GYS2)
   04922 Glucagon signaling pathway
    101131537 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    101131537 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ggo01003]
    101131537 (GYS2)
Enzymes [BR:ggo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     101131537 (GYS2)
Glycosyltransferases [BR:ggo01003]
 Polysaccharide
  Storage polysaccharide
   101131537 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_1_4 Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 101131537
NCBI-ProteinID: XP_004052904
Ensembl: ENSGGOG00000006428
UniProt: G3QU91
LinkDB All DBs
Position
12
AA seq 703 aa AA seqDB search
MLRGRSLSVTSLGGLPQWEVEELPVEELLLFEVAWEVTNKVGGIYTVIQTKAKTTADEWG
ENYFLIGPYFEHNMKTQVEQCEPVNDAVRRAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
GYSAWNLDRWKGDLWEACSVGIPYHDREANDMLIFGSLTAWFLKEVTDHADGKHVVAQFH
EWQAGIGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSDI
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDVAHSVKEKFGKKLYDALLRGEIPDLNDIL
DRDDLTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTKFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHVELTSPPTTEGFKYPRPSSVPPSPSGSQASSPQSSDVE
DEVEDERYDEEEEAERDRLNIKSPFSLSHVPHGKKKLHGEYKN
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggccgatccctgtctgtaacatccctgggtgggcttccccagtgggaagtc
gaagaacttcctgtggaggagttactgctctttgaagttgcttgggaagtgaccaataaa
gttggaggcatctatactgtgattcagacaaaggccaaaacaacagcagatgaatgggga
gagaactattttctgataggtccatattttgagcataatatgaagactcaggtggaacag
tgtgaacctgtaaatgatgctgtcagaagagcagtggatgcaatgaataagcatggctgc
caggtgcattttggaagatggctgatagaaggaagtccttatgtggtactttttgacata
ggctattcagcttggaatctggacaggtggaagggtgacctctgggaagcatgcagtgtt
ggcattccttatcatgaccgagaagccaacgatatgctgatatttggatctttaactgcc
tggttcttaaaagaggtgacagatcatgcagatggtaaacatgtcgttgcccaattccat
gaatggcaggctggaattggactgatcctttctcgagccaggaaacttcctattgccaca
atatttacaacccacgctacactacttgggaggtatctctgtgcagcaaatattgatttc
tacaaccatcttgataagtttaacattgacaaagaggctggggaaaggcagatttaccac
cggtactgcatggagcgagcttccgttcattgcgctcacgtgttcaccacggtttctgaa
ataacagcaatagaggctgaacatatgctgaagagaaagcctgatgtagttactccaaac
ggcttgaatgttaagaaattttcagcagtgcatgagtttcaaaatctacatgccatgtac
aaggccagaatccaagattttgttcgaggtcatttctatggtcatctcgacttcgatctt
gaaaagactttgttccttttcattgctgggaggtatgagttttcaaacaaaggagctgac
atcttcctagaatccttatccaggctaaatttcctgctgaggatgcataaaagtgacatc
acagtggtggtgtttttcattatgcctgccaagacaaataatttcaacgtggaaaccctg
aaaggacaagcagtgcgaaaacagctgtgggatgttgcacattctgtaaaggaaaagttt
ggaaaaaaactctacgatgcattattaagaggagaaattcctgacctgaatgatatttta
gatcgagatgatctaacaattatgaaaagagccatcttttcaactcagcgacagtcattg
cccccagtgaccacgcacaacatgattgatgactccaccgaccccatcctcagcaccatt
aggcggattggacttttcaacaaccgcacagatagagtcaaggtgattttgcacccagag
tttctatcctccaccagtcccttactacccatggactatgaagagtttgttagaggttgt
catcttggagtatttccatcatactatgaaccctggggttatactccagctgaatgcact
gtgatgggtatccccagtgtgaccacgaatctctccgggtttggctgtttcatgcaggag
cacgtggctgatcctactgcttacggtatttacatcgttgacaggcggttccgttctcca
gatgattcttgcaatcagctgactaagtttctctatggattttgcaaacagtcacgccgc
caaaggattatccagaggaacagaactgagaggctctcagatcttctggattggagatac
ttaggcagatattaccagcatgccagacacctgacattaagcagagcttttccagataaa
ttccatgtggaactaacatcaccaccaacgacagaaggatttaaatatcccaggccttcc
tcagtaccaccttctccttcagggtctcaggcctccagtcctcagagcagtgatgtggaa
gatgaagtggaggatgagagatacgatgaggaagaggaggctgaaagggatcggttaaat
atcaagtcaccattttcactgagccacgttcctcatgggaagaaaaagctgcatggtgaa
tataagaactga

DBGET integrated database retrieval system