KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101131972Help
Entry
101131972         CDS       T02442                                 

Gene name
SDHB
Definition
(RefSeq) succinate dehydrogenase complex iron sulfur subunit B
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00020  Citrate cycle (TCA cycle)
ggo00190  Oxidative phosphorylation
ggo01100  Metabolic pathways
ggo01200  Carbon metabolism
ggo04714  Thermogenesis
ggo04932  Non-alcoholic fatty liver disease (NAFLD)
ggo05010  Alzheimer disease
ggo05012  Parkinson disease
ggo05016  Huntington disease
Module
ggo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ggo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ggo_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101131972 (SDHB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101131972 (SDHB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101131972 (SDHB)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    101131972 (SDHB)
   05012 Parkinson disease
    101131972 (SDHB)
   05016 Huntington disease
    101131972 (SDHB)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101131972 (SDHB)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     101131972 (SDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer2 Fer4_9 Fer4_18 Fer4_7
Motif
Other DBs
NCBI-GeneID: 101131972
NCBI-ProteinID: XP_018867234
Ensembl: ENSGGOG00000016273
UniProt: G3RJI3
LinkDB All DBs
Position
1
AA seq 280 aa AA seqDB search
MAAVVALSLRRRLPATTLGGACLQASRGAQTAAATAPRIKKFAIYRWDPDKAGDKPHMQT
YEVDLNKCGPMVLDALIKIKNEVDSTLTFRRSCREGICGSCAMNINGGNTLACTRRIDTN
LNKVSKIYPLPHMYVIKDLVPDLSNFYAQYKSIEPYLKKKDESQEGKQQYLQSIEEREKL
DGLYECILCACCSTSCPSYWWNGDKYLGPAVLMQAYRWMIDSRDDFTEERLAKLQDPFSL
YRCHTIMNCTRTCPKGLNPGKAIAEIKKMMATYKEKKASV
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtggtcgcactctccttgaggcgccggttaccggccacaacccttggcgga
gcctgcctgcaggcctcccgaggagcccagacagctgcagccactgctccccgtatcaag
aaatttgccatctatcgatgggacccagacaaggctggagacaaacctcatatgcagact
tatgaagttgaccttaataaatgtggccccatggtattggatgctttaatcaagattaag
aatgaagttgactctactttgaccttccgaagatcatgcagagaaggcatctgtggctct
tgtgcaatgaacatcaatggaggcaacactctagcttgcacccgaaggattgacaccaac
ctcaataaggtctcaaaaatctaccctcttccacacatgtatgtgataaaggatcttgtt
cccgatttgagcaacttctatgcacagtacaaatccattgagccttatttgaagaagaag
gatgaatctcaggaaggcaagcagcagtatctgcagtccatagaagagcgtgagaaactg
gacgggctctacgagtgcattctctgtgcctgctgtagcaccagctgccccagctactgg
tggaacggagacaaatatctggggcctgcagttcttatgcaggcctatcgctggatgatt
gactccagagacgacttcacagaggagcgcctggccaagctgcaggacccattctctcta
taccgctgccacaccatcatgaactgcacaaggacctgtcctaagggtctgaatccaggg
aaagctattgcggagatcaagaaaatgatggcaacctataaggagaagaaagcttcagtt
taa

DBGET integrated database retrieval system