KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101132215
Entry
101132215         CDS       T02442                                 

Definition
(RefSeq) neuroendocrine secretory protein 55
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04024  cAMP signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04724  Glutamatergic synapse
ggo04726  Serotonergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04962  Vasopressin-regulated water reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05012  Parkinson disease
ggo05030  Cocaine addiction
ggo05031  Amphetamine addiction
ggo05032  Morphine addiction
ggo05034  Alcoholism
ggo05142  Chagas disease
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05165  Human papillomavirus infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101132215
   04020 Calcium signaling pathway
    101132215
   04072 Phospholipase D signaling pathway
    101132215
   04024 cAMP signaling pathway
    101132215
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101132215
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101132215
  09152 Endocrine system
   04911 Insulin secretion
    101132215
   04922 Glucagon signaling pathway
    101132215
   04923 Regulation of lipolysis in adipocytes
    101132215
   04912 GnRH signaling pathway
    101132215
   04913 Ovarian steroidogenesis
    101132215
   04915 Estrogen signaling pathway
    101132215
   04921 Oxytocin signaling pathway
    101132215
   04926 Relaxin signaling pathway
    101132215
   04935 Growth hormone synthesis, secretion and action
    101132215
   04918 Thyroid hormone synthesis
    101132215
   04928 Parathyroid hormone synthesis, secretion and action
    101132215
   04916 Melanogenesis
    101132215
   04924 Renin secretion
    101132215
   04925 Aldosterone synthesis and secretion
    101132215
   04927 Cortisol synthesis and secretion
    101132215
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101132215
   04270 Vascular smooth muscle contraction
    101132215
  09154 Digestive system
   04970 Salivary secretion
    101132215
   04971 Gastric acid secretion
    101132215
   04972 Pancreatic secretion
    101132215
   04976 Bile secretion
    101132215
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101132215
   04961 Endocrine and other factor-regulated calcium reabsorption
    101132215
  09156 Nervous system
   04724 Glutamatergic synapse
    101132215
   04728 Dopaminergic synapse
    101132215
   04726 Serotonergic synapse
    101132215
   04730 Long-term depression
    101132215
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101132215
  09159 Environmental adaptation
   04713 Circadian entrainment
    101132215
   04714 Thermogenesis
    101132215
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101132215
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101132215
  09165 Substance dependence
   05030 Cocaine addiction
    101132215
   05031 Amphetamine addiction
    101132215
   05032 Morphine addiction
    101132215
   05034 Alcoholism
    101132215
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101132215
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101132215
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101132215
   05165 Human papillomavirus infection
    101132215
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101132215
   05142 Chagas disease
    101132215
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101132215
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101132215
   04031 GTP-binding proteins [BR:ggo04031]
    101132215
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101132215
  Exosomal proteins of other body fluids (saliva and urine)
   101132215
  Exosomal proteins of colorectal cancer cells
   101132215
  Exosomal proteins of bladder cancer cells
   101132215
GTP-binding proteins [BR:ggo04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    101132215
SSDB
Motif
Pfam: NESP55
Other DBs
NCBI-GeneID: 101132215
NCBI-ProteinID: XP_030860649
LinkDB
Position
20
AA seq 245 aa
MDRRSRAQQWRRARHNYNDLCPPIGRRAATALLWLSCSIALLRALATSNARAQQRAAAQQ
RRSFLNAHHRSGAQVFPESPESESDHEHEEADLELSLPECLEYEEEFDYETESETESEIE
SETDFETEPETAPTTEPETEPEDDRGPVVPKHSTFGQSLTQRLHALKLRSPDASPSRAPP
STQEPQSPREGEELKPEDKDPRDPEESKEPKEEKQRRRCKPKKPTRRDASPESPSKKGPI
PIRRH
NT seq 738 nt   +upstreamnt  +downstreamnt
atggatcggaggtcccgggctcagcagtggcgccgagctcgccataattacaacgacctg
tgcccgcccataggccgccgggcagccaccgcgctcctctggctctcctgctccatcgcg
ctcctccgcgcccttgccacctccaacgcccgtgcccagcagcgcgccgctgcccaacag
cgccggagcttccttaacgcccaccaccgctccggcgcccaggtattccctgagtccccc
gaatcggaatctgaccacgagcacgaggaggcagaccttgagctgtccctccccgagtgc
ctagagtacgaggaagagttcgactacgagaccgagagcgagaccgagtccgaaatcgag
tccgagaccgacttcgagaccgagcctgagaccgcccccaccactgagcccgagaccgag
cctgaagacgatcgcggcccggtggtgcccaagcactccaccttcggccagtccctcacc
cagcgtctgcacgctctcaagttgcgaagccccgacgcctccccaagtcgcgcgccgccc
agcactcaggagccccagagccccagggaaggggaggagctcaagcccgaggacaaagat
ccaagggaccccgaagagtcgaaggagcccaaggaggagaagcagcggcgtcgctgcaag
ccaaagaagcccacccgccgtgacgcgtccccggagtccccttctaaaaagggacccatc
cccatccggcgtcactaa

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 109023045
Entry
109023045         CDS       T02442                                 

Gene name
GNAS
Definition
(RefSeq) guanine nucleotide-binding protein G(s) subunit alpha isoform X10
  KO
K04632  guanine nucleotide-binding protein G(s) subunit alpha
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04015  Rap1 signaling pathway
ggo04020  Calcium signaling pathway
ggo04024  cAMP signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04724  Glutamatergic synapse
ggo04726  Serotonergic synapse
ggo04728  Dopaminergic synapse
ggo04730  Long-term depression
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04962  Vasopressin-regulated water reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04972  Pancreatic secretion
ggo04976  Bile secretion
ggo05012  Parkinson disease
ggo05030  Cocaine addiction
ggo05031  Amphetamine addiction
ggo05032  Morphine addiction
ggo05034  Alcoholism
ggo05142  Chagas disease
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05165  Human papillomavirus infection
ggo05200  Pathways in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    109023045 (GNAS)
   04020 Calcium signaling pathway
    109023045 (GNAS)
   04072 Phospholipase D signaling pathway
    109023045 (GNAS)
   04024 cAMP signaling pathway
    109023045 (GNAS)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    109023045 (GNAS)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    109023045 (GNAS)
  09152 Endocrine system
   04911 Insulin secretion
    109023045 (GNAS)
   04922 Glucagon signaling pathway
    109023045 (GNAS)
   04923 Regulation of lipolysis in adipocytes
    109023045 (GNAS)
   04912 GnRH signaling pathway
    109023045 (GNAS)
   04913 Ovarian steroidogenesis
    109023045 (GNAS)
   04915 Estrogen signaling pathway
    109023045 (GNAS)
   04921 Oxytocin signaling pathway
    109023045 (GNAS)
   04926 Relaxin signaling pathway
    109023045 (GNAS)
   04935 Growth hormone synthesis, secretion and action
    109023045 (GNAS)
   04918 Thyroid hormone synthesis
    109023045 (GNAS)
   04928 Parathyroid hormone synthesis, secretion and action
    109023045 (GNAS)
   04916 Melanogenesis
    109023045 (GNAS)
   04924 Renin secretion
    109023045 (GNAS)
   04925 Aldosterone synthesis and secretion
    109023045 (GNAS)
   04927 Cortisol synthesis and secretion
    109023045 (GNAS)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    109023045 (GNAS)
   04270 Vascular smooth muscle contraction
    109023045 (GNAS)
  09154 Digestive system
   04970 Salivary secretion
    109023045 (GNAS)
   04971 Gastric acid secretion
    109023045 (GNAS)
   04972 Pancreatic secretion
    109023045 (GNAS)
   04976 Bile secretion
    109023045 (GNAS)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    109023045 (GNAS)
   04961 Endocrine and other factor-regulated calcium reabsorption
    109023045 (GNAS)
  09156 Nervous system
   04724 Glutamatergic synapse
    109023045 (GNAS)
   04728 Dopaminergic synapse
    109023045 (GNAS)
   04726 Serotonergic synapse
    109023045 (GNAS)
   04730 Long-term depression
    109023045 (GNAS)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    109023045 (GNAS)
  09159 Environmental adaptation
   04713 Circadian entrainment
    109023045 (GNAS)
   04714 Thermogenesis
    109023045 (GNAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    109023045 (GNAS)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    109023045 (GNAS)
  09165 Substance dependence
   05030 Cocaine addiction
    109023045 (GNAS)
   05031 Amphetamine addiction
    109023045 (GNAS)
   05032 Morphine addiction
    109023045 (GNAS)
   05034 Alcoholism
    109023045 (GNAS)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    109023045 (GNAS)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109023045 (GNAS)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    109023045 (GNAS)
   05165 Human papillomavirus infection
    109023045 (GNAS)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    109023045 (GNAS)
   05142 Chagas disease
    109023045 (GNAS)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    109023045 (GNAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    109023045 (GNAS)
   04031 GTP-binding proteins [BR:ggo04031]
    109023045 (GNAS)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   109023045 (GNAS)
  Exosomal proteins of other body fluids (saliva and urine)
   109023045 (GNAS)
  Exosomal proteins of colorectal cancer cells
   109023045 (GNAS)
  Exosomal proteins of bladder cancer cells
   109023045 (GNAS)
GTP-binding proteins [BR:ggo04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 2 (Gs)
    109023045 (GNAS)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA Roc GTP_EFTU
Other DBs
NCBI-GeneID: 109023045
NCBI-ProteinID: XP_004062488
LinkDB
Position
20
AA seq 335 aa
MRILHVNGFNGEGGEEDPQAARSNSDGEKATKVQDIKNNLKEAIETIVAAMSNLVPPVEL
ANPENQFRVDYILSVMNVPDFDFPPEFYEHAKALWEDEGVRACYERSNEYQLIDCAQYFL
DKIDVIKQADYVPSDQDLLRCRVLTSGIFETKFQVDKVNFHMFDVGGQRDERRKWIQCFN
DVTAIIFVVASSSYNMVIREDNQTNRLQEALNLFKSIWNNRWLRTISVILFLNKQDLLAE
KVLAGKSKIEDYFPEFARYTTPEDATPEPGEDPRVTRAKYFIRDEFLRISTASGDGRHYC
YPHFTCAVDTENIRRVFNDCRDIIQRMHLRQYELL
NT seq 1008 nt   +upstreamnt  +downstreamnt
atgaggatcctgcatgttaatgggtttaatggagagggcggcgaagaggacccgcaggct
gcaaggagcaacagcgatggtgagaaggcaaccaaagtgcaggacatcaaaaacaacctg
aaagaggcgattgaaaccattgtggccgccatgagcaacctggtgccccccgtggagctg
gccaaccccgagaaccagttcagagtggactacattctgagtgtgatgaacgtgcctgac
tttgacttccctcccgaattctatgagcatgccaaggctctgtgggaggatgaaggagtg
cgtgcctgctacgaacgctccaacgagtaccagctgattgactgtgcccagtacttcctg
gacaagatcgacgtgatcaagcaggctgactatgtgccgagcgatcaggacctgcttcgc
tgccgcgtcctgacttctggaatctttgagaccaagttccaggtggacaaagtcaacttc
cacatgtttgacgtgggtggccagcgcgacgaacgccgcaagtggatccagtgcttcaac
gatgtgactgccatcatcttcgtggtggccagcagcagctacaacatggtcatccgggag
gacaaccagaccaaccgcctgcaggaggctctgaacctcttcaagagcatctggaacaac
agatggctgcgcaccatctctgtgattctgttcctcaacaagcaagatctgctcgctgag
aaagtccttgctgggaaatcgaagattgaggactactttccagaatttgctcgctacact
actcctgaggatgctactcccgagcccggagaggacccacgcgtgacccgggccaagtac
ttcattcgagatgagtttctgaggatcagcactgccagtggagatgggcgtcactactgc
taccctcatttcacctgcgctgtggacactgagaacatccgccgtgtgttcaacgactgc
cgtgacatcattcagcgcatgcaccttcgtcagtacgagctgctctaa

DBGET integrated database retrieval system