KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101132394
Entry
101132394         CDS       T02442                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04060  Cytokine-cytokine receptor interaction
ggo04061  Viral protein interaction with cytokine and cytokine receptor
ggo04151  PI3K-Akt signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04630  JAK-STAT signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04672  Intestinal immune network for IgA production
ggo04940  Type I diabetes mellitus
ggo05135  Yersinia infection
ggo05142  Chagas disease
ggo05162  Measles
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05320  Autoimmune thyroid disease
ggo05321  Inflammatory bowel disease
ggo05330  Allograft rejection
ggo05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101132394 (IL2)
   04151 PI3K-Akt signaling pathway
    101132394 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101132394 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    101132394 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101132394 (IL2)
   04660 T cell receptor signaling pathway
    101132394 (IL2)
   04658 Th1 and Th2 cell differentiation
    101132394 (IL2)
   04659 Th17 cell differentiation
    101132394 (IL2)
   04672 Intestinal immune network for IgA production
    101132394 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101132394 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101132394 (IL2)
   05321 Inflammatory bowel disease
    101132394 (IL2)
   05330 Allograft rejection
    101132394 (IL2)
   05332 Graft-versus-host disease
    101132394 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101132394 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101132394 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101132394 (IL2)
   05162 Measles
    101132394 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    101132394 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ggo04052]
    101132394 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:ggo00536]
    101132394 (IL2)
Cytokines and growth factors [BR:ggo04052]
 Cytokines
  Interleukins
   101132394 (IL2)
Glycosaminoglycan binding proteins [BR:ggo00536]
 Heparan sulfate / Haparin
  Cytokines
   101132394 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD Polysacc_synt_3
Other DBs
NCBI-GeneID: 101132394
NCBI-ProteinID: XP_004040401
Ensembl: ENSGGOG00000023337
UniProt: G3S1Y8
LinkDB
Position
4
AA seq 153 aa
MYRMQLLFCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgttttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctt
acatttaagttttacatgcccaagaaggccacagaactgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agacccagggacttaatcagcaatatcaatgtaatagttctggaactaaagggatctgaa
acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga
tggattaccttttgtcagagcatcatctcaacactgacttga

DBGET integrated database retrieval system