KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101132913
Entry
101132913         CDS       T02442                                 

Gene name
IL3
Definition
(RefSeq) interleukin-3
  KO
K04736  interleukin 3
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04060  Cytokine-cytokine receptor interaction
ggo04151  PI3K-Akt signaling pathway
ggo04210  Apoptosis
ggo04630  JAK-STAT signaling pathway
ggo04640  Hematopoietic cell lineage
ggo04664  Fc epsilon RI signaling pathway
ggo05200  Pathways in cancer
ggo05202  Transcriptional misregulation in cancer
ggo05221  Acute myeloid leukemia
ggo05310  Asthma
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101132913 (IL3)
   04151 PI3K-Akt signaling pathway
    101132913 (IL3)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101132913 (IL3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101132913 (IL3)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101132913 (IL3)
   04664 Fc epsilon RI signaling pathway
    101132913 (IL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101132913 (IL3)
   05202 Transcriptional misregulation in cancer
    101132913 (IL3)
  09162 Cancer: specific types
   05221 Acute myeloid leukemia
    101132913 (IL3)
  09163 Immune disease
   05310 Asthma
    101132913 (IL3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ggo04052]
    101132913 (IL3)
   00536 Glycosaminoglycan binding proteins [BR:ggo00536]
    101132913 (IL3)
Cytokines and growth factors [BR:ggo04052]
 Cytokines
  Interleukins
   101132913 (IL3)
Glycosaminoglycan binding proteins [BR:ggo00536]
 Heparan sulfate / Haparin
  Cytokines
   101132913 (IL3)
SSDB
Motif
Pfam: IL3 Ldl_recept_b
Other DBs
NCBI-GeneID: 101132913
NCBI-ProteinID: XP_004042511
Ensembl: ENSGGOG00000001048
UniProt: G3QFG0
LinkDB
Position
5
AA seq 152 aa
MSRLPVLLLLQLLVRPGLQAPMTQTTSLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLN
GEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIRIKD
GDWNEFRRKLTFYLKTLENAQAQQTTLSLAIS
NT seq 459 nt   +upstreamnt  +downstreamnt
atgagccgcctgcctgtcctgctcctgctccaactcctggtccgccccggactccaagct
cccatgacccagacgacgtccttgaagacaagctgggttaactgctctaacatgatcgat
gaaattataacacacttaaagcagccacctttgcctttgctggacttcaacaacctcaat
ggggaagaccaagacattctgatggaaaataaccttcgaaggccaaacctggaggcattc
aacagggctgtcaagagtttacagaacgcatcagcaatcgagagcattcttaagaatctc
ctgccatgtctgcccctggccacggccgcacccacgcgacatccaatccgtatcaaggac
ggtgactggaatgaattccggaggaaactgacgttctatctgaaaacccttgagaatgcg
caggctcaacagacgactttgagcctcgcgatctcttga

DBGET integrated database retrieval system