KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101133000Help
Entry
101133000         CDS       T02442                                 

Gene name
ALPI
Definition
(RefSeq) alkaline phosphatase, intestinal
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00730  Thiamine metabolism
ggo00790  Folate biosynthesis
ggo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    101133000 (ALPI)
   00790 Folate biosynthesis
    101133000 (ALPI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ggo04147]
    101133000 (ALPI)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ggo00537]
    101133000 (ALPI)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     101133000 (ALPI)
Exosome [BR:ggo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101133000 (ALPI)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:ggo00537]
 Enzymes
  101133000 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme
Motif
Other DBs
NCBI-GeneID: 101133000
NCBI-ProteinID: XP_004033406
Ensembl: ENSGGOG00000005653
UniProt: G3RWG5
LinkDB All DBs
Position
2B
AA seq 528 aa AA seqDB search
MQGPWVLLLLGLRLQLSLGVIPAEEENPAFWNRQAAEALDAAKKLQPIQKVAKNLILFLG
DGLGVPTVTATRILKGQKNGKLGPETPLAMDRFPYLALSKTYNVDRQVPDSAATATAYLC
GVKANFQTIGLSAAARFNQCNTTRGNEVISVMNRAKQAGKSVGVVTTTRVQHASPAGTYA
HTVNRNWYSDADMPASARQDGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPSDA
SQNGIRLDGKNLVQEWLAKHQGAWYVWNRTELMQASLDQSVTHLMGLFEPGDTKYEINRD
PTLDPSLMEMTEAALRLLSRNPRGFYLFVEGGRIDHGHHEGVAYQALTEAVMFDDTIERA
GQLTSEEDTLTLVTADHSHVFSFGGYTLRGSSIFGLAPSKAQDSKAYTSILYGNGPGYVF
NSGVRPDVNDSESGSPDYQQQAAVPLSSETHGGEDVAVFARGPQAHLVHGVQEQSFVAHV
MAFAACLEPYTACDLALPACTTDAAHPVAASLPLLAGTLLLLGASAAP
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgcaggggccctgggtgctgctgctgctgggcctgaggctacagctctccctgggcgtc
atcccagctgaggaggagaacccggccttctggaaccgccaggcagctgaggccctggat
gctgccaagaagctgcagcccatccagaaggtcgccaagaacctcatcctcttcctgggc
gatgggttgggggtgcccacggtgacagccaccaggatcctaaaggggcagaagaatggc
aaactggggcctgagacgcccctggccatggaccgcttcccatacctggctctgtccaag
acatacaatgtggacagacaggtgccagacagcgcagccacagccacggcctacctgtgc
ggggtcaaggccaacttccagaccatcggcttgagtgcagccgcccgctttaaccagtgc
aacacgacacgcggcaatgaggtcatctccgtgatgaaccgggccaagcaagcaggaaag
tcagtaggagtggtgaccaccacacgggtgcagcacgcctcaccagccggcacctacgca
cacacagtgaaccgcaactggtactcagatgctgacatgcctgcctcagcccgccaggat
ggctgccaggacatcgccacgcagctcatctccaacatggacattgacgtgatccttggc
ggaggccgcaagtacatgtttcccatggggaccccagaccctgagtacccaagtgatgcc
agccagaatggaatcaggctggacgggaagaacctggtgcaggaatggctggcaaagcac
cagggtgcctggtatgtgtggaaccgcactgagctcatgcaggcgtccctggaccagtct
gtgacccatctcatgggcctctttgagcccggagacacgaaatatgagatcaaccgagac
cccacgctggacccctccctgatggagatgacagaggctgccctgcgcctgctgagcagg
aaccctcgaggcttctacctctttgtggagggcggccgcatcgaccatggtcatcatgag
ggtgtggcttaccaggcactcactgaggcggtcatgttcgacgacaccattgagagggcg
ggccagctcaccagcgaggaggacacgctgaccctcgtcaccgctgaccactcccatgtc
ttctcctttggtggctacaccttgcgagggagctccatcttcgggttggcccccagcaag
gctcaggacagcaaagcctacacgtccatcctgtacggcaatggcccgggctacgtgttc
aactcaggcgtgcgaccagacgtgaatgacagcgagagcgggagccccgattaccagcag
caggcggcggtgcccctgtcgtccgagacccacggaggcgaagacgtggcggtgtttgcg
cgcggcccgcaggcgcacctggtgcatggtgtgcaggagcagagctttgtagcgcatgtc
atggccttcgctgcctgtctggagccctacacggcctgcgacctggcgcttcccgcctgc
accaccgacgccgcgcacccggttgccgcgtcgctgccactgctggccgggaccctgctg
ctgctgggggcgtccgctgctccctga

DBGET integrated database retrieval system