KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101133308
Entry
101133308         CDS       T02442                                 

Gene name
ELK1
Definition
(RefSeq) LOW QUALITY PROTEIN: ETS domain-containing protein Elk-1
  KO
K04375  ETS domain-containing protein Elk-1
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04510  Focal adhesion
ggo04910  Insulin signaling pathway
ggo04912  GnRH signaling pathway
ggo04921  Oxytocin signaling pathway
ggo05140  Leishmaniasis
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05205  Proteoglycans in cancer
ggo05213  Endometrial cancer
ggo05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101133308 (ELK1)
   04012 ErbB signaling pathway
    101133308 (ELK1)
   04014 Ras signaling pathway
    101133308 (ELK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101133308 (ELK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101133308 (ELK1)
   04912 GnRH signaling pathway
    101133308 (ELK1)
   04921 Oxytocin signaling pathway
    101133308 (ELK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101133308 (ELK1)
   05205 Proteoglycans in cancer
    101133308 (ELK1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101133308 (ELK1)
   05213 Endometrial cancer
    101133308 (ELK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101133308 (ELK1)
   05161 Hepatitis B
    101133308 (ELK1)
   05163 Human cytomegalovirus infection
    101133308 (ELK1)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    101133308 (ELK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ggo03000]
    101133308 (ELK1)
Transcription factors [BR:ggo03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    101133308 (ELK1)
SSDB
Motif
Pfam: Ets
Other DBs
NCBI-GeneID: 101133308
NCBI-ProteinID: XP_004064125
Ensembl: ENSGGOG00000008714
LinkDB
Position
X
AA seq 429 aa
MDPPVTLWHFLLQLLREQGNGHIISWTSCDGGEFKLVVAQEVAXPWGRRKNKTNVNYVKL
RRALRYYYDKNIIRKVSGQKFVYKFVSYPEVAGCSTEEDCPPQPEVSVTXAVAVVAPAAI
HAAPGDTVSGKPGTPKGAGMAGPGGLARSSRNEYMRSGLYSTFTIQSLQPQPPPHPRPAV
VLPNAAPAGAAAPPSGSRSTSPSPLEACLEAEEAGLPLQVILTPPEAPNLKSEELNVEPG
LGRALPPEVKVEGPKEELEVAGXRGFVPETTKAEPEVPPQEGVPARLPXVLTDTAGQAGG
HAASSPEISQPQKGRKPRDLELPLSPSLLGGPGPERTPGSGSGSGLQAPGPALTPSLLPT
HTLTPVLLTPSSLPPSIHFWSTLSPIAPRSPAKLSFQFPSSGSAQVHIPSISVDGLSTPV
VLSPGPQKP
NT seq 1290 nt   +upstreamnt  +downstreamnt
atggacccacctgtgacgctgtggcactttctgctgcagctgctgagagagcaaggcaac
ggccacatcatctcctggacttcatgcgatggtggtgaattcaagctggtggttgcacag
gaggtggcctagccgtgggggcgacgcaagaacaagaccaacgtgaattacgtcaagctc
aggcgggccttgcggtactactatgacaagaacatcatccgcaaggtgagcggccagaag
tttgtctacaagtttgtgtcctaccctgaggtcgcagggtgctccactgaggaggactgc
ccaccccagccagaggtgtctgttactnccgccgtggcagttgtggcccctgctgctata
catgccgccccaggggacaccgtctctggaaagccaggcacacccaagggtgcaggaatg
gcaggcccaggcggtttggcgcgcagcagccggaacgagtacatgcgctcgggcctctat
tccaccttcaccatccagtctctgcagccgcagccaccccctcatcctcggcctgctgtg
gtgctccccaatgcagctcctgcaggggcagcagcgcccccctcggggagcaggagcacc
agtccaagccccttggaggcctgtctggaggctgaagaggccggcttgcctctgcaggtc
atcctgacaccgcccgaggccccaaacctgaaatcggaagagctgaatgtggagccgggt
ttgggccgggctttgcccccagaagtgaaagtagaagggcccaaggaagagttggaagtt
gcggggnngagagggtttgtgccagaaaccaccaaggccgagccagaagtccctccacag
gagggcgtgccagcccggctgccgnaggtccttacggacaccgcagggcaggcgggcggc
catgcggcttccagccctgagatctcccagccgcagaagggccggaagccccgggaccta
gagcttccactcagcccgagcctgctaggtgggccgggacccgaacggaccccaggatcg
ggaagtggctccggcctccaggctccggggccggcgctgaccccatccctgcttcctacg
catacattgaccccggtgctgctgacacccagctcgctgcctcccagcattcacttctgg
agcaccctgagtcccattgcgccccgtagcccggccaagctctccttccagtttccatcc
agtggcagcgcccaggtgcacatcccttccatcagcgtggatggcctctcgacccccgtg
gtgctctccccagggccccagaagccatga

DBGET integrated database retrieval system