KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134060
Entry
101134060         CDS       T02442                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04020  Calcium signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04260  Cardiac muscle contraction
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04727  GABAergic synapse
ggo04728  Dopaminergic synapse
ggo04742  Taste transduction
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04927  Cortisol synthesis and secretion
ggo04929  GnRH secretion
ggo04930  Type II diabetes mellitus
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo05010  Alzheimer disease
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05031  Amphetamine addiction
ggo05410  Hypertrophic cardiomyopathy
ggo05412  Arrhythmogenic right ventricular cardiomyopathy
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101134060 (CACNA1C)
   04020 Calcium signaling pathway
    101134060 (CACNA1C)
   04024 cAMP signaling pathway
    101134060 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    101134060 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101134060 (CACNA1C)
   04929 GnRH secretion
    101134060 (CACNA1C)
   04912 GnRH signaling pathway
    101134060 (CACNA1C)
   04921 Oxytocin signaling pathway
    101134060 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    101134060 (CACNA1C)
   04924 Renin secretion
    101134060 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    101134060 (CACNA1C)
   04927 Cortisol synthesis and secretion
    101134060 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101134060 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    101134060 (CACNA1C)
   04270 Vascular smooth muscle contraction
    101134060 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    101134060 (CACNA1C)
   04727 GABAergic synapse
    101134060 (CACNA1C)
   04725 Cholinergic synapse
    101134060 (CACNA1C)
   04728 Dopaminergic synapse
    101134060 (CACNA1C)
   04726 Serotonergic synapse
    101134060 (CACNA1C)
   04720 Long-term potentiation
    101134060 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    101134060 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    101134060 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101134060 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101134060 (CACNA1C)
   05020 Prion disease
    101134060 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    101134060 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    101134060 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    101134060 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    101134060 (CACNA1C)
   05414 Dilated cardiomyopathy
    101134060 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101134060 (CACNA1C)
   04934 Cushing syndrome
    101134060 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ggo04040]
    101134060 (CACNA1C)
Ion channels [BR:ggo04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101134060 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel
Other DBs
NCBI-GeneID: 101134060
NCBI-ProteinID: XP_018893770
Ensembl: ENSGGOG00000002738
LinkDB
Position
12
AA seq 2224 aa
MVNENTRMYIPEENHQGSNYGSPRPAHANMNANAAAGLAPEHIPTPGAALSWQAAIDAAR
QAKLMGSAGNATISTVSSTQRKRQQYGKPKKQGSTTATRPPRALLCLTLKNPIRRACISI
VEWKYPLPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLK
VIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKT
CYNQEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVF
QCITMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKA
RGDFQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGMDEEKPRNMSMPTSETESVNTE
NVAGGDIEGENCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSNVFYWLVIFLVFLN
TLTIASEHYNQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFVVC
GGILETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLL
LFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIM
AYGGPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKK
LARTASPEKKQELVEKPAVGESKEEKIELKSITADGESPPATKINMDDLQPNENEDKSPY
PNPETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSSNNRFRLQCHRIV
NDTIFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKILGNAD
YVFTSIFTLEIILKMTAYGAFLHKGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKIL
RVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYT
CSDSSKQTEAECKGNYITYKDGEVDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGW
PELLYRSIDSHTEDKGPIYNYRVEISIFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEY
KNCELDKNQRQCVEYALKARPLRRYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLA
MQHYGQSCLFKIAMNILNMLFTGLFTVEMILKLIAFKPKGYFSDPWNVFDFLIVIGSIID
VILSETNHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPSMNAEENSRISITFFR
LFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQVFGKIALND
TTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPSNSTEGETPCGS
SFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWAEYDPEAK
GRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNATLFALVRTA
LRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYATFLIQEYFR
KFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIGPEIRRAISGDLTAEEELDKAMKEAVSA
ASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTFTTQRPLHINKAGSSQGDTESPSHEKLV
DSTFTPSSYSSTGSNANINNANNTALGRLPRPAGYPSTVSTVEGHGPPLSPAIRVQEVAW
KLSSNRARHVLVCEDLELRRDSGSAGTQAHCLLLRRANPSRCHSRESQAAMAGQEETSQD
ETCEVKMNHDTEACSEPSLLSTEMLSYQDDENRQLTLPEEDKRDIRQSPKRGFLRSASLG
RRASFHLECLKRQKDRGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPASFPRPFAT
PPATPGSRGWPPQPVPTLRLEGVESSEKLNSSFPSIHCGSWAETTPGGGGSSAARRARPV
SLMVPSQAGAPGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIEEM
ESAADNILSGGAPQSPNGALLPFVNCRDAGQDRAGGEEDAGCVRARGRLSEEELQDSRVY
VSSL
NT seq 6675 nt   +upstreamnt  +downstreamnt
atggtcaatgagaatacgaggatgtacattccagaggaaaaccaccaaggttccaactat
gggagcccacgccccgcccatgccaacatgaatgccaatgcggcagcggggctggcccct
gagcacatccccaccccgggggccgccctgtcctggcaggcggccatcgacgcagcccgg
caggctaagctgatgggcagcgctggcaatgcgaccatctccacagtcagctccacgcag
cggaagcggcagcaatatgggaaacccaagaagcagggcagcaccacggccacacgcccg
ccccgagccctgctctgcctgaccctgaagaaccccatccggagggcctgcatcagcatt
gtcgaatggaaatatcctttaccatttgaaattattattttactgactatttttgccaat
tgtgtggccttagcgatctatattccctttccagaagatgattccaacgccaccaattcc
aacctggaacgagtggaatatctctttctcataatttttacggtggaagcgtttttaaaa
gtaatcgcctatggactcctctttcaccccaatgcctacctccgcaacggctggaaccta
ctagattttataattgtggttgtggggctttttagtgcaattttagaacaagcaaccaaa
gcagatggggcaaacgctctcggagggaaaggggccggatttgatgtgaaggcgctgagg
gccttccgcgtgctgcgccccctgcggctggtgtccggagtcccaagtctccaggtggtc
ctgaattccatcatcaaggccatggtccccctgctgcacatcgccctgcttgtgctgttt
gtcatcatcatctacgccatcatcggcttggagctcttcatggggaagatgcacaagacc
tgctacaaccaggagggcatagcagatgttccagcagaagatgacccttccccttgtgcg
ctggaaacgggccacgggcggcagtgccagaacggcacagtgtgcaagcccggctgggat
ggtcccaagcacggcatcaccaactttgacaactttgccttcgccatgctcacggtgttc
cagtgcatcaccatggagggctggacggacgtgctgtactgggtcaatgatgccgtagga
agggactggccctggatctattttgttacactaatcatcatagggtcattttttgtactt
aacttggttctcggtgtgcttagcggagagttttccaaagagagggagaaggccaaggcc
cggggagatttccagaagctgcgggagaagcagcagctagaagaggatctcaaaggctac
ctggattggatcactcaggccgaagacatcgatcccgagaatgaggacgaaggcatggat
gaggagaagccccgaaacatgagcatgcccaccagtgagaccgagtccgtcaacaccgaa
aacgtggctggaggtgacatcgagggagaaaactgcggggccaggctggcccaccggatc
tccaagtcaaagttcagccgctactggcgccggtggaatcggttctgcagaaggaagtgc
cgcgccgcagtcaagtctaatgtcttctactggctggtgattttcctggtgttcctcaac
acgctcaccattgcctctgagcactacaaccagccccactggctcacagaagtccaagac
acggcaaacaaggccctgctggccctgttcacggcggagatgctcttgaagatgtacagc
ctgggcctgcaggcctacttcgtgtccctcttcaaccgctttgactgcttcgtcgtgtgt
ggtggcatcctggagaccatcctggtggagaccaagatcatgtccccactgggcatctcc
gtgctcagatgcgtccggctgctgaggatattcaagatcacgaggtactggaactccttg
agcaacctggtggcatccttgctgaactctgtgcgctccatcgcctccctgctccttctc
ctcttcctcttcatcatcatcttctccctcctggggatgcagctctttggaggaaagttc
aactttgatgagatgcagacccggaggagcacattcgataacttcccccagtccctcctc
actgtgtttcagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatg
gcttatggcggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttc
atctgtggaaactatatcctactgaatgtgttcttggccattgctgtggacaacctggct
gatgctgagagcctcacatctgcccaaaaggaggaggaagaggagaaggagagaaagaag
ctggccaggactgccagcccagagaagaaacaagagttggtggagaagccggcagtgggg
gaatccaaggaggagaagattgagctgaaatccatcacggctgacggagagtctccaccc
gccaccaagatcaacatggatgacctccagcccaatgaaaatgaggataagagcccctac
cccaacccagaaactacaggagaagaggatgaggaggagccagagatgcctgtcggccct
cgcccacgaccactctctgagcttcaccttaaggaaaaggcagtgcccatgccagaagcc
agcgcgtttttcatcttcagctctaacaacaggtttcgcctccagtgccaccgcattgtc
aatgacacgatcttcaccaacctgatcctcttcttcattctgctcagcagcatttccctg
gctgctgaggacccggtccagcacacctccttcaggaaccatattctgttttattttgat
attgtttttaccaccattttcaccattgaaattgctctgaagatcctaggcaatgcagac
tatgtcttcactagtatctttacattagaaattatccttaagatgactgcttatggggct
ttcctgcacaagggctctttctgccggaactacttcaacatcctggacctgctggtggtc
agcgtgtccctcatctcctttggcatccagtccagtgcaatcaatgtcgtgaagatcttg
cgagtcctgcgagtactcaggcccctgagggccatcaacagggccaaggggctaaagcat
gtggttcagtgtgtgtttgtcgccatccggaccatcgggaacatcgtgattgtcaccacc
ctgctgcagttcatgtttgcctgcatcggggtccagctcttcaagggaaagctgtacacc
tgttcagacagttccaagcagacagaggcggaatgcaagggcaactacatcacgtacaaa
gatggggaggttgaccatcccatcatccaaccccgcagctgggagaacagcaagtttgac
tttgacaatgttctggcagccatgatggccctcttcaccgtctccaccttcgaagggtgg
ccagagctgctgtaccgctccatcgactcccacacggaagacaagggccccatctacaac
taccgtgtggagatctccatcttcttcatcatctacatcatcatcatcgccttcttcatg
atgaacatcttcgtgggcttcgtcatcgtcacctttcaggagcagggggagcaggagtac
aagaactgtgagctggacaagaaccagcggcagtgcgtggaatacgccctcaaggcccgg
cccctgcggaggtacatccccaagaaccagcaccagtacaaagtgtggtacgtggtcaac
tccacctacttcgagtacctgatgtttgtcctcatcctgctcaacaccatctgcctggcc
atgcagcactacggccagagctgcctgttcaaaatcgccatgaacatcctcaacatgctc
ttcactggcctcttcaccgtggagatgatcctgaagctcattgccttcaaacccaagggt
tactttagtgatccctggaatgtttttgacttcctcatcgtaattggcagcataattgac
gtcattctcagtgagactaatcactatttctgtgatgcatggaatacatttgacgccttg
attgttgtgggtagcattgttgatatagcaatcaccgaggtaaacccagctgaacatacc
caatgctctccctctatgaacgcagaggaaaactcccgcatctccatcaccttcttccgc
ctgttccgggtcatgcgtctggtgaagctgctgagccgtggggagggcatccggacgctg
ctgtggaccttcatcaagtccttccaggccctgccctatgtggccctcctgatcgtgatg
ctgttcttcatctacgcggtgatcgggatgcaggtgtttgggaaaattgccctgaatgat
accacagagatcaaccggaacaacaactttcagaccttcccccaggccgtgctgctcctc
ttcaggtgtgccaccggggaggcctggcaggacatcatgctggcctgcatgccaggcaag
aagtgtgccccagagtccgagcccagcaacagcacagagggtgaaacaccctgtggtagc
agctttgctgtcttctacttcatcagcttctacatgctctgtgccttcctgatcatcaac
ctctttgtagctgtcatcatggacaactttgactacctgacaagggactggtccatcctt
ggtccccaccacctggatgagtttaaaagaatctgggcagagtatgaccctgaagccaag
ggtcgtatcaaacacctggatgtggtgaccctcctccggcggattcagccgccactaggt
tttgggaagctgtgccctcaccgcgtggcttgcaaacgcttggtctccatgaacatgcct
ctgaacagtgacgggacagtcatgttcaatgccactctgtttgccctggtcaggacggcc
ctgaggatcaaaacagaagggaacctagaacaagccaatgaggagctgcgggcgatcatc
aagaagatctggaagcggaccagcatgaagctgctggaccaggtggtgccccctgcaggt
gatgatgaggtcaccgttggcaagttctacgccacgttcctaatccaggagtacttccgg
aagttcaagaagcgcaaagagcagggccttgtgggcaagccctcccagaggaacgcgctg
tctctgcaggctggcttgcgcacactgcatgacatcgggcctgagatccgacgggccatc
tctggagatctcaccgctgaggaggagctggacaaggccatgaaggaggctgtgtccgct
gcttctgaagatgacatattcaggagggccggtggcctgttcggcaaccacgtcagctac
taccaaagcgacggccggagcgccttcccccagaccttcaccactcagcgcccgctgcac
atcaacaaggcgggcagcagccagggcgacactgagtcgccatcccacgagaagctggtg
gactccaccttcaccccgagcagctactcgtccaccggctccaatgccaacatcaacaac
gccaacaacaccgccctgggtcgcctccctcgccccgccggctaccccagcacggtcagc
actgtggagggccatgggccccccttgtcccctgccatccgggtgcaggaggtggcgtgg
aagctcagctccaacagggcaaggcacgttctggtgtgtgaggatctggagctcaggagg
gattcaggctcagcagggactcaggctcactgccttctgctcaggagagcaaacccctct
aggtgccactcccgggagagccaggcagccatggcgggtcaggaggagacgtctcaggat
gagacctgtgaagtgaagatgaaccatgacacggaggcctgcagtgagcccagcctgctc
tccacagagatgctctcctaccaggatgacgaaaatcggcaactgacgctcccagaggag
gacaagagggacatccggcaatctccgaagaggggtttcctccgctctgcctcactaggt
cgaagggcctccttccacctggaatgtctgaagcgacagaaggaccgagggggagacatc
tctcagaagacagtcctgcccttgcatctggttcatcatcaggcattggcagtggcaggc
ctgagccccctcctccagagaagccattcccctgcctcattccccaggccttttgccacc
ccaccagccacacctggcagccgaggctggcccccacagcccgtccccaccctgcggctg
gagggggttgagtccagtgagaaactcaacagcagcttcccatccatccactgcggctcc
tgggctgagaccacccccggtggcgggggcagcagcgccgcccggagagcccggcccgtc
tccctcatggtgcccagccaggctggggccccagggaggcagttccacggcagtgccagc
agcctggtggaagcggtcttgatttcagaaggactggggcagtttgctcaagatcccaag
ttcatcgaggtcaccacccaggagctggccgacgcctgcgacatgaccatagaggagatg
gagagcgcggccgacaacatcctcagcgggggcgccccacagagccccaatggcgccctc
ttaccctttgtgaactgcagggacgcggggcaggaccgagccgggggcgaagaggacgcg
ggctgtgtgcgcgcgcggggtcgactgagtgaggaggagctccaggacagcagggtctac
gtcagcagcctgtag

DBGET integrated database retrieval system