KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134135Help
Entry
101134135         CDS       T02442                                 

Gene name
TMPRSS2
Definition
(RefSeq) transmembrane protease, serine 2
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo05164  Influenza A
ggo05202  Transcriptional misregulation in cancer
ggo05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    101134135 (TMPRSS2)
  09162 Cancers: Specific types
   05215 Prostate cancer
    101134135 (TMPRSS2)
  09172 Infectious diseases: Viral
   05164 Influenza A
    101134135 (TMPRSS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ggo01002]
    101134135 (TMPRSS2)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101134135 (TMPRSS2)
Peptidases [BR:ggo01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101134135 (TMPRSS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Hepsin-SRCR SRCR DUF1986 Trypsin_2 Ldl_recept_a
Motif
Other DBs
NCBI-GeneID: 101134135
NCBI-ProteinID: XP_004062887
Ensembl: ENSGGOG00000004836
UniProt: G3SFM5
LinkDB All DBs
Position
21
AA seq 492 aa AA seqDB search
MALNSGSPPAIGPYYENHGYQPENPYPAQPTVAPTVYEVHPAQYYPSPVPQYAPRVLTQA
SNPVVRTQPKSPSGTVCTSKTKKALCITLTLGTFLVGAALAAGLLWKFMGSKCSDSGIEC
DSSGTCISPSNWCDGVSHCPSGEDENRCVRLYGPNFILQVYSSQRKSWHPVCQDDWNENY
GRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHSDACSSKAVVSLR
CIACGVNLNSSRQSRIVGGVSALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEK
PLNNPWHWTAFAGILRQSFMFYEAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDL
VKPVCLPNPGMMLEPEQLCWISGWGATEEKGKTSEVLNAARVLLIETQKCNSRYVYDNLI
TPAMICAGFLQGNVDSCQGDSGGPLVTLKNNVWWLIGDTSWGSGCAKAYRPGVYGNVTVF
TDWIYRQMRADG
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggctttgaactcagggtcaccaccagctattggaccttactatgaaaaccatggatac
caaccggaaaacccctatcccgcacagcccactgtggcccccactgtctacgaggtgcat
ccggctcagtactacccgtcccccgtgccccagtacgccccgagggtcctgacgcaggct
tccaaccccgtcgtccgcacgcagcccaaatccccatctggcacagtgtgcacctcaaag
actaagaaagcactgtgcatcaccttgaccctggggaccttcctcgtgggagctgcgctg
gccgctggcctactctggaagttcatgggcagcaagtgctccgactctgggatagagtgc
gactcctcaggtacctgcatcagcccctctaactggtgtgatggtgtgtcacactgcccc
agcggggaggacgagaatcggtgtgttcgcctctacggaccaaacttcatccttcaggtg
tactcatctcagaggaagtcctggcaccctgtgtgccaagacgactggaacgagaactac
gggcgggcagcctgcagggacatgggctataagaataatttttactctagccaaggaata
gtggatgacagcggatccaccagctttatgaaactgaacacaagtgccggcaatgtcgat
atctataaaaaactgtaccacagtgatgcctgttcttcaaaagcagtggtttctttacgc
tgtatagcctgtggggtcaacttgaactcaagccgccagagcaggatcgtgggcggcgtg
agcgcgctcccgggggcctggccctggcaggtcagcctgcacgtccagaacgtccacgtg
tgcggaggctccatcatcacccccgagtggatcgtgacagccgcccactgcgtggaaaaa
cctcttaacaatccatggcattggacggcatttgcggggattttgagacaatctttcatg
ttctatgaagccggataccaagtagaaaaagtgatttctcatccaaattatgactccaag
accaagaataacgacattgcgctgatgaagctgcagaagcctctgactttcaatgactta
gtgaaaccagtgtgtctgcccaacccaggcatgatgctggagccagaacagctctgctgg
atttccgggtggggggccaccgaggagaaagggaagacctcagaagtgctgaacgctgcc
agggtacttctcattgagacgcagaaatgcaacagcagatatgtctatgacaacctgatc
acaccagccatgatctgtgccggcttcctgcaggggaacgtcgattcttgccagggtgac
agtggagggcctctggtcactttgaagaacaatgtctggtggctgatcggggatacaagc
tggggttctggctgtgccaaagcttacagaccaggagtgtacgggaatgtgacggtattc
acggactggatttatcgacaaatgagggcagacggctaa

DBGET integrated database retrieval system