KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134260
Entry
101134260         CDS       T02442                                 

Gene name
PRKACB
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit beta isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04020  Calcium signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04114  Oocyte meiosis
ggo04140  Autophagy - animal
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04310  Wnt signaling pathway
ggo04340  Hedgehog signaling pathway
ggo04371  Apelin signaling pathway
ggo04530  Tight junction
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04727  GABAergic synapse
ggo04728  Dopaminergic synapse
ggo04740  Olfactory transduction
ggo04742  Taste transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04910  Insulin signaling pathway
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04962  Vasopressin-regulated water reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04976  Bile secretion
ggo05012  Parkinson disease
ggo05020  Prion disease
ggo05030  Cocaine addiction
ggo05031  Amphetamine addiction
ggo05032  Morphine addiction
ggo05034  Alcoholism
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05165  Human papillomavirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05203  Viral carcinogenesis
ggo05205  Proteoglycans in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101134260 (PRKACB)
   04014 Ras signaling pathway
    101134260 (PRKACB)
   04310 Wnt signaling pathway
    101134260 (PRKACB)
   04340 Hedgehog signaling pathway
    101134260 (PRKACB)
   04371 Apelin signaling pathway
    101134260 (PRKACB)
   04020 Calcium signaling pathway
    101134260 (PRKACB)
   04024 cAMP signaling pathway
    101134260 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101134260 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101134260 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101134260 (PRKACB)
   04540 Gap junction
    101134260 (PRKACB)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101134260 (PRKACB)
   04062 Chemokine signaling pathway
    101134260 (PRKACB)
  09152 Endocrine system
   04911 Insulin secretion
    101134260 (PRKACB)
   04910 Insulin signaling pathway
    101134260 (PRKACB)
   04922 Glucagon signaling pathway
    101134260 (PRKACB)
   04923 Regulation of lipolysis in adipocytes
    101134260 (PRKACB)
   04912 GnRH signaling pathway
    101134260 (PRKACB)
   04913 Ovarian steroidogenesis
    101134260 (PRKACB)
   04915 Estrogen signaling pathway
    101134260 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    101134260 (PRKACB)
   04921 Oxytocin signaling pathway
    101134260 (PRKACB)
   04926 Relaxin signaling pathway
    101134260 (PRKACB)
   04935 Growth hormone synthesis, secretion and action
    101134260 (PRKACB)
   04918 Thyroid hormone synthesis
    101134260 (PRKACB)
   04919 Thyroid hormone signaling pathway
    101134260 (PRKACB)
   04928 Parathyroid hormone synthesis, secretion and action
    101134260 (PRKACB)
   04916 Melanogenesis
    101134260 (PRKACB)
   04924 Renin secretion
    101134260 (PRKACB)
   04925 Aldosterone synthesis and secretion
    101134260 (PRKACB)
   04927 Cortisol synthesis and secretion
    101134260 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101134260 (PRKACB)
   04270 Vascular smooth muscle contraction
    101134260 (PRKACB)
  09154 Digestive system
   04970 Salivary secretion
    101134260 (PRKACB)
   04971 Gastric acid secretion
    101134260 (PRKACB)
   04976 Bile secretion
    101134260 (PRKACB)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101134260 (PRKACB)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101134260 (PRKACB)
  09156 Nervous system
   04724 Glutamatergic synapse
    101134260 (PRKACB)
   04727 GABAergic synapse
    101134260 (PRKACB)
   04725 Cholinergic synapse
    101134260 (PRKACB)
   04728 Dopaminergic synapse
    101134260 (PRKACB)
   04726 Serotonergic synapse
    101134260 (PRKACB)
   04720 Long-term potentiation
    101134260 (PRKACB)
   04723 Retrograde endocannabinoid signaling
    101134260 (PRKACB)
  09157 Sensory system
   04740 Olfactory transduction
    101134260 (PRKACB)
   04742 Taste transduction
    101134260 (PRKACB)
   04750 Inflammatory mediator regulation of TRP channels
    101134260 (PRKACB)
  09149 Aging
   04211 Longevity regulating pathway
    101134260 (PRKACB)
   04213 Longevity regulating pathway - multiple species
    101134260 (PRKACB)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101134260 (PRKACB)
   04714 Thermogenesis
    101134260 (PRKACB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101134260 (PRKACB)
   05205 Proteoglycans in cancer
    101134260 (PRKACB)
   05203 Viral carcinogenesis
    101134260 (PRKACB)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101134260 (PRKACB)
   05020 Prion disease
    101134260 (PRKACB)
  09165 Substance dependence
   05030 Cocaine addiction
    101134260 (PRKACB)
   05031 Amphetamine addiction
    101134260 (PRKACB)
   05032 Morphine addiction
    101134260 (PRKACB)
   05034 Alcoholism
    101134260 (PRKACB)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101134260 (PRKACB)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101134260 (PRKACB)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101134260 (PRKACB)
   05163 Human cytomegalovirus infection
    101134260 (PRKACB)
   05165 Human papillomavirus infection
    101134260 (PRKACB)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101134260 (PRKACB)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101134260 (PRKACB)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101134260 (PRKACB)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: AGC group
  PKA family
   101134260 (PRKACB)
Messenger RNA biogenesis [BR:ggo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101134260 (PRKACB)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101134260 (PRKACB)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like
Other DBs
NCBI-GeneID: 101134260
NCBI-ProteinID: XP_004026083
Ensembl: ENSGGOG00000027086
UniProt: G3SC72
LinkDB
Position
1
AA seq 398 aa
MAAYREPPCNQYTGTTTALQKLEGFASRLFHRHSKGTAHDQKTALENDSLHFSEHTALWD
RSMKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVSDIKTHKWFATTDWIAIYQRKVEA
PFIPKFRGSGDTSNFDDYEEEDIRVSITEKCAKEFGEF
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggcagcttatagagaaccaccttgtaaccagtatacaggtacaactacagctcttcag
aaattggaaggttttgctagccggttatttcatagacactctaaaggtactgcacatgat
cagaaaacagctctggaaaatgacagccttcatttctctgaacatactgccttatgggac
agatcaatgaaagagtttctagccaaagccaaagaagactttttgaaaaaatgggagaat
ccaactcagaataatgccggacttgaagattttgaaaggaaaaaaacccttggaacaggt
tcatttggaagagtcatgttggtaaaacacaaagccactgaacagtattatgccatgaag
atcttagataagcagaaggttgttaaactgaagcaaatagagcatactttgaatgagaaa
agaatattacaggcagtgaattttcctttccttgttcgactggagtatgcttttaaggat
aattctaatttatacatggttatggaatatgtccctgggggtgaaatgttttcacatcta
agacgaattggaaggttcagtgagccccatgcacggttctatgcagctcagatagtgcta
acattcgagtacctccattcactagacctcatctacagagatctaaaacctgaaaatctc
ttaattgaccatcaaggctatatccaggtcacagactttgggtttgccaaaagagttaaa
ggcagaacttggacattatgtggaactccagagtatttggctccagaaataattctcagc
aagggctacaataaggcagtggattggtgggcattaggagtgctaatctatgaaatggca
gctggctatcccccattctttgcagaccaaccaattcagatttatgaaaagattgtttct
ggaaaggtccgattcccatcccacttcagttcagatctcaaggaccttctacggaacctg
ctgcaggtggatttgaccaagagatttggaaatctaaagaatggtgtcagtgatataaaa
actcacaagtggtttgccacgacagattggattgctatttaccagaggaaggttgaagct
ccattcataccaaagtttagaggctctggagataccagcaactttgatgactatgaagaa
gaagatatccgtgtctctataacagaaaaatgtgcaaaagaatttggtgaattttaa

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101151469
Entry
101151469         CDS       T02442                                 

Gene name
PRKACG
Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit gamma
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04014  Ras signaling pathway
ggo04020  Calcium signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04114  Oocyte meiosis
ggo04140  Autophagy - animal
ggo04211  Longevity regulating pathway
ggo04213  Longevity regulating pathway - multiple species
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04270  Vascular smooth muscle contraction
ggo04310  Wnt signaling pathway
ggo04340  Hedgehog signaling pathway
ggo04371  Apelin signaling pathway
ggo04530  Tight junction
ggo04540  Gap junction
ggo04611  Platelet activation
ggo04713  Circadian entrainment
ggo04714  Thermogenesis
ggo04720  Long-term potentiation
ggo04723  Retrograde endocannabinoid signaling
ggo04724  Glutamatergic synapse
ggo04725  Cholinergic synapse
ggo04726  Serotonergic synapse
ggo04727  GABAergic synapse
ggo04728  Dopaminergic synapse
ggo04740  Olfactory transduction
ggo04742  Taste transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04910  Insulin signaling pathway
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04913  Ovarian steroidogenesis
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04918  Thyroid hormone synthesis
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04923  Regulation of lipolysis in adipocytes
ggo04924  Renin secretion
ggo04925  Aldosterone synthesis and secretion
ggo04926  Relaxin signaling pathway
ggo04927  Cortisol synthesis and secretion
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04934  Cushing syndrome
ggo04935  Growth hormone synthesis, secretion and action
ggo04961  Endocrine and other factor-regulated calcium reabsorption
ggo04962  Vasopressin-regulated water reabsorption
ggo04970  Salivary secretion
ggo04971  Gastric acid secretion
ggo04976  Bile secretion
ggo05012  Parkinson disease
ggo05020  Prion disease
ggo05030  Cocaine addiction
ggo05031  Amphetamine addiction
ggo05032  Morphine addiction
ggo05034  Alcoholism
ggo05146  Amoebiasis
ggo05163  Human cytomegalovirus infection
ggo05165  Human papillomavirus infection
ggo05166  Human T-cell leukemia virus 1 infection
ggo05200  Pathways in cancer
ggo05203  Viral carcinogenesis
ggo05205  Proteoglycans in cancer
ggo05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101151469 (PRKACG)
   04014 Ras signaling pathway
    101151469 (PRKACG)
   04310 Wnt signaling pathway
    101151469 (PRKACG)
   04340 Hedgehog signaling pathway
    101151469 (PRKACG)
   04371 Apelin signaling pathway
    101151469 (PRKACG)
   04020 Calcium signaling pathway
    101151469 (PRKACG)
   04024 cAMP signaling pathway
    101151469 (PRKACG)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101151469 (PRKACG)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101151469 (PRKACG)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101151469 (PRKACG)
   04540 Gap junction
    101151469 (PRKACG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101151469 (PRKACG)
   04062 Chemokine signaling pathway
    101151469 (PRKACG)
  09152 Endocrine system
   04911 Insulin secretion
    101151469 (PRKACG)
   04910 Insulin signaling pathway
    101151469 (PRKACG)
   04922 Glucagon signaling pathway
    101151469 (PRKACG)
   04923 Regulation of lipolysis in adipocytes
    101151469 (PRKACG)
   04912 GnRH signaling pathway
    101151469 (PRKACG)
   04913 Ovarian steroidogenesis
    101151469 (PRKACG)
   04915 Estrogen signaling pathway
    101151469 (PRKACG)
   04914 Progesterone-mediated oocyte maturation
    101151469 (PRKACG)
   04921 Oxytocin signaling pathway
    101151469 (PRKACG)
   04926 Relaxin signaling pathway
    101151469 (PRKACG)
   04935 Growth hormone synthesis, secretion and action
    101151469 (PRKACG)
   04918 Thyroid hormone synthesis
    101151469 (PRKACG)
   04919 Thyroid hormone signaling pathway
    101151469 (PRKACG)
   04928 Parathyroid hormone synthesis, secretion and action
    101151469 (PRKACG)
   04916 Melanogenesis
    101151469 (PRKACG)
   04924 Renin secretion
    101151469 (PRKACG)
   04925 Aldosterone synthesis and secretion
    101151469 (PRKACG)
   04927 Cortisol synthesis and secretion
    101151469 (PRKACG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101151469 (PRKACG)
   04270 Vascular smooth muscle contraction
    101151469 (PRKACG)
  09154 Digestive system
   04970 Salivary secretion
    101151469 (PRKACG)
   04971 Gastric acid secretion
    101151469 (PRKACG)
   04976 Bile secretion
    101151469 (PRKACG)
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    101151469 (PRKACG)
   04961 Endocrine and other factor-regulated calcium reabsorption
    101151469 (PRKACG)
  09156 Nervous system
   04724 Glutamatergic synapse
    101151469 (PRKACG)
   04727 GABAergic synapse
    101151469 (PRKACG)
   04725 Cholinergic synapse
    101151469 (PRKACG)
   04728 Dopaminergic synapse
    101151469 (PRKACG)
   04726 Serotonergic synapse
    101151469 (PRKACG)
   04720 Long-term potentiation
    101151469 (PRKACG)
   04723 Retrograde endocannabinoid signaling
    101151469 (PRKACG)
  09157 Sensory system
   04740 Olfactory transduction
    101151469 (PRKACG)
   04742 Taste transduction
    101151469 (PRKACG)
   04750 Inflammatory mediator regulation of TRP channels
    101151469 (PRKACG)
  09149 Aging
   04211 Longevity regulating pathway
    101151469 (PRKACG)
   04213 Longevity regulating pathway - multiple species
    101151469 (PRKACG)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101151469 (PRKACG)
   04714 Thermogenesis
    101151469 (PRKACG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101151469 (PRKACG)
   05205 Proteoglycans in cancer
    101151469 (PRKACG)
   05203 Viral carcinogenesis
    101151469 (PRKACG)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101151469 (PRKACG)
   05020 Prion disease
    101151469 (PRKACG)
  09165 Substance dependence
   05030 Cocaine addiction
    101151469 (PRKACG)
   05031 Amphetamine addiction
    101151469 (PRKACG)
   05032 Morphine addiction
    101151469 (PRKACG)
   05034 Alcoholism
    101151469 (PRKACG)
  09166 Cardiovascular disease
   05414 Dilated cardiomyopathy
    101151469 (PRKACG)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101151469 (PRKACG)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101151469 (PRKACG)
   05163 Human cytomegalovirus infection
    101151469 (PRKACG)
   05165 Human papillomavirus infection
    101151469 (PRKACG)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101151469 (PRKACG)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101151469 (PRKACG)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101151469 (PRKACG)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: AGC group
  PKA family
   101151469 (PRKACG)
Messenger RNA biogenesis [BR:ggo03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101151469 (PRKACG)
Chromosome and associated proteins [BR:ggo03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101151469 (PRKACG)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo RIO1
Other DBs
NCBI-GeneID: 101151469
NCBI-ProteinID: XP_004048149
LinkDB
Position
9
AA seq 351 aa
MGNAPTKKDTEQEESMNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVML
VRHRGTGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLV
MEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAFQYLHSLDLIHRDLKPENLLIDQQGY
LQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAMGFPPFY
ADQPIQIYEKIVSGRVRFPSKLSSDLKDLLRNLLQVDLTKRFGNLRNGVGDIKNHKWFAT
TNWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCAKEFSEF
NT seq 1056 nt   +upstreamnt  +downstreamnt
atgggcaacgcccccaccaagaaggacaccgagcaggaggagagcatgaacgagttccta
gccaaagccagaggagatttcctctacagatggggaaaccccgctcaaaacaccgccagc
tcggatcagttcgaacggcttaggacgctgggcatgggctccttcgggcgggtgatgctg
gtgaggcaccgggggaccggcggccactacgccatgaagatcctcaacaagcagaaggtg
gtgaagatgaagcaggtcgagcacatactgaacgagaagcgcatcctgcaggcgatcgac
tttccgttcctcgtcaagctccagttctcctttaaggacaactcctacctgtacctggtg
atggagtacgtgccgggtggggagatgttctcccgcctacagcgcgtcggaaggtttagc
gaaccccatgcctgtttctatgccgcccaggtcgtcctggccttccagtacctacactcg
ctcgacctcatccaccgcgacctgaagcccgagaatctcctcatcgaccagcagggctac
ctgcaggtgacggacttcggtttcgccaagcgcgtgaagggccgcacttggaccttgtgc
gggaccccagagtacctggcccccgagatcatcctgagcaaaggctacaacaaggccgtg
gactggtgggccctaggggtgctcatctatgagatggccatgggctttccacccttctac
gccgaccagcccatccagatctacgagaagatcgtctctgggagggtgcggtttccctcc
aaactcagctctgacctcaaggatctgctgcggaacctcctgcaggtggacctcaccaag
cgcttcggaaacctcaggaacggggttggcgacatcaagaaccacaagtggttcgccaca
accaactggatcgccatctatgagaagaaggtggaagctcccttcatcccgaagtacaca
ggccctggggatgccagtaactttgacgactacgaggaggaagagctccggatctccatc
aatgagaagtgtgccaaggagttttctgagttttag

DBGET integrated database retrieval system