KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134492
Entry
101134492         CDS       T02442                                 

Gene name
MAPK12
Definition
(RefSeq) mitogen-activated protein kinase 12 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04015  Rap1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04114  Oocyte meiosis
ggo04218  Cellular senescence
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04370  VEGF signaling pathway
ggo04380  Osteoclast differentiation
ggo04550  Signaling pathways regulating pluripotency of stem cells
ggo04611  Platelet activation
ggo04613  Neutrophil extracellular trap formation
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04670  Leukocyte transendothelial migration
ggo04714  Thermogenesis
ggo04722  Neurotrophin signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04728  Dopaminergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04917  Prolactin signaling pathway
ggo04926  Relaxin signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04935  Growth hormone synthesis, secretion and action
ggo05014  Amyotrophic lateral sclerosis
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05135  Yersinia infection
ggo05140  Leishmaniasis
ggo05142  Chagas disease
ggo05145  Toxoplasmosis
ggo05152  Tuberculosis
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05171  Coronavirus disease - COVID-19
ggo05205  Proteoglycans in cancer
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101134492 (MAPK12)
   04015 Rap1 signaling pathway
    101134492 (MAPK12)
   04370 VEGF signaling pathway
    101134492 (MAPK12)
   04668 TNF signaling pathway
    101134492 (MAPK12)
   04068 FoxO signaling pathway
    101134492 (MAPK12)
   04071 Sphingolipid signaling pathway
    101134492 (MAPK12)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101134492 (MAPK12)
   04218 Cellular senescence
    101134492 (MAPK12)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101134492 (MAPK12)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101134492 (MAPK12)
   04613  Neutrophil extracellular trap formation
    101134492 (MAPK12)
   04620 Toll-like receptor signaling pathway
    101134492 (MAPK12)
   04621 NOD-like receptor signaling pathway
    101134492 (MAPK12)
   04622 RIG-I-like receptor signaling pathway
    101134492 (MAPK12)
   04625 C-type lectin receptor signaling pathway
    101134492 (MAPK12)
   04660 T cell receptor signaling pathway
    101134492 (MAPK12)
   04658 Th1 and Th2 cell differentiation
    101134492 (MAPK12)
   04659 Th17 cell differentiation
    101134492 (MAPK12)
   04657 IL-17 signaling pathway
    101134492 (MAPK12)
   04664 Fc epsilon RI signaling pathway
    101134492 (MAPK12)
   04670 Leukocyte transendothelial migration
    101134492 (MAPK12)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101134492 (MAPK12)
   04914 Progesterone-mediated oocyte maturation
    101134492 (MAPK12)
   04917 Prolactin signaling pathway
    101134492 (MAPK12)
   04926 Relaxin signaling pathway
    101134492 (MAPK12)
   04935 Growth hormone synthesis, secretion and action
    101134492 (MAPK12)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101134492 (MAPK12)
  09156 Nervous system
   04728 Dopaminergic synapse
    101134492 (MAPK12)
   04723 Retrograde endocannabinoid signaling
    101134492 (MAPK12)
   04722 Neurotrophin signaling pathway
    101134492 (MAPK12)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101134492 (MAPK12)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101134492 (MAPK12)
  09159 Environmental adaptation
   04714 Thermogenesis
    101134492 (MAPK12)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101134492 (MAPK12)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101134492 (MAPK12)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101134492 (MAPK12)
   05020 Prion disease
    101134492 (MAPK12)
   05022 Pathways of neurodegeneration - multiple diseases
    101134492 (MAPK12)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101134492 (MAPK12)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101134492 (MAPK12)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101134492 (MAPK12)
   05135 Yersinia infection
    101134492 (MAPK12)
   05133 Pertussis
    101134492 (MAPK12)
   05152 Tuberculosis
    101134492 (MAPK12)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101134492 (MAPK12)
   05161 Hepatitis B
    101134492 (MAPK12)
   05171 Coronavirus disease - COVID-19
    101134492 (MAPK12)
   05163 Human cytomegalovirus infection
    101134492 (MAPK12)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101134492 (MAPK12)
   05169 Epstein-Barr virus infection
    101134492 (MAPK12)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101134492 (MAPK12)
   05140 Leishmaniasis
    101134492 (MAPK12)
   05142 Chagas disease
    101134492 (MAPK12)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101134492 (MAPK12)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101134492 (MAPK12)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101134492 (MAPK12)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101134492 (MAPK12)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kdo Kinase-like
Other DBs
NCBI-GeneID: 101134492
NCBI-ProteinID: XP_030863196
Ensembl: ENSGGOG00000014464
LinkDB
Position
Unknown
AA seq 367 aa
MSSPPPARSGFYRQEVTKTAWEVRAVYRDLQPVGSGAYGAVCSAVDNRTGAKVAIKKLYR
PFQSELFAKRAYRELRLLKHMRHENVIGLLDVFTPDETLDNFTDFYLVMPFMGTDLGKLM
KHEKLGEDRIQFLVYQMLKGLRYIHAAGIIHRDLKPGNLAVNEDCELKILDFGLARQADS
EMTGYVVTRWYRAPEVILNWMRYTQTVDIWSVGCIMAEMITGKTLFKGSDHLDQLKEIMK
VTGTPPAEFVQRLQSDEAKNYMKGLPEWEKKDFASILTNASPLAVNLLEKMLVLDAEQRV
TAAEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDGWKRVTYKEVLSFKPPRQLGAR
VSKETAL
NT seq 1104 nt   +upstreamnt  +downstreamnt
atgagctctccgccgcccgcccgcagtggcttttaccgccaggaggtgaccaagacggcc
tgggaggtgcgcgccgtgtaccgggacctgcagccggtgggctcgggcgcctacggcgcg
gtgtgctcggccgtggacaaccgcaccggcgctaaggtggccatcaagaagctgtatcgg
cccttccagtccgagctgttcgccaagcgcgcctaccgcgagctgcgcctgctcaagcac
atgcgccacgagaacgtgatcgggctgctggacgtattcactcctgatgagaccctggat
aacttcacagacttttacctggtgatgccgttcatgggcaccgacctgggcaagctcatg
aaacatgagaagctaggcgaggaccggatccagttcctcgtgtaccagatgctgaagggg
ctgaggtatatccacgctgccggcatcatccacagagacctgaagcccggcaacctggct
gtgaacgaagactgtgagctgaagatcctggactttggcctggccagacaggcagacagt
gagatgactgggtacgtggtgacccggtggtaccgggctcccgaggtcatcttgaattgg
atgcgctacacgcagacggtggacatctggtctgtgggctgcatcatggcggagatgatc
acaggcaagacgctattcaagggcagcgaccacctggaccagctgaaggagatcatgaag
gtgacggggacgcctccggctgagtttgtgcagcggctgcagagcgatgaggccaagaac
tacatgaagggcctccccgaatgggagaagaaggattttgcctccatcctgaccaatgca
agccctctggctgtgaacctcctggagaagatgctggtgctggacgcggagcagcgggtg
acggcagccgaggcgctggcccatccctacttcgagtccctgcacgacacggaagatgag
ccccaggtccagaagtatgatgactcctttgacgacgtggaccgcacactggatggatgg
aagcgtgttacttacaaagaggtgctcagcttcaagcctccccggcagctgggggccagg
gtctccaaggagacggctctgtga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134843
Entry
101134843         CDS       T02442                                 

Gene name
MAPK11
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04015  Rap1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04114  Oocyte meiosis
ggo04218  Cellular senescence
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04370  VEGF signaling pathway
ggo04380  Osteoclast differentiation
ggo04550  Signaling pathways regulating pluripotency of stem cells
ggo04611  Platelet activation
ggo04613  Neutrophil extracellular trap formation
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04670  Leukocyte transendothelial migration
ggo04714  Thermogenesis
ggo04722  Neurotrophin signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04728  Dopaminergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04917  Prolactin signaling pathway
ggo04926  Relaxin signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04935  Growth hormone synthesis, secretion and action
ggo05014  Amyotrophic lateral sclerosis
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05135  Yersinia infection
ggo05140  Leishmaniasis
ggo05142  Chagas disease
ggo05145  Toxoplasmosis
ggo05152  Tuberculosis
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05171  Coronavirus disease - COVID-19
ggo05205  Proteoglycans in cancer
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101134843 (MAPK11)
   04015 Rap1 signaling pathway
    101134843 (MAPK11)
   04370 VEGF signaling pathway
    101134843 (MAPK11)
   04668 TNF signaling pathway
    101134843 (MAPK11)
   04068 FoxO signaling pathway
    101134843 (MAPK11)
   04071 Sphingolipid signaling pathway
    101134843 (MAPK11)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101134843 (MAPK11)
   04218 Cellular senescence
    101134843 (MAPK11)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101134843 (MAPK11)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101134843 (MAPK11)
   04613  Neutrophil extracellular trap formation
    101134843 (MAPK11)
   04620 Toll-like receptor signaling pathway
    101134843 (MAPK11)
   04621 NOD-like receptor signaling pathway
    101134843 (MAPK11)
   04622 RIG-I-like receptor signaling pathway
    101134843 (MAPK11)
   04625 C-type lectin receptor signaling pathway
    101134843 (MAPK11)
   04660 T cell receptor signaling pathway
    101134843 (MAPK11)
   04658 Th1 and Th2 cell differentiation
    101134843 (MAPK11)
   04659 Th17 cell differentiation
    101134843 (MAPK11)
   04657 IL-17 signaling pathway
    101134843 (MAPK11)
   04664 Fc epsilon RI signaling pathway
    101134843 (MAPK11)
   04670 Leukocyte transendothelial migration
    101134843 (MAPK11)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101134843 (MAPK11)
   04914 Progesterone-mediated oocyte maturation
    101134843 (MAPK11)
   04917 Prolactin signaling pathway
    101134843 (MAPK11)
   04926 Relaxin signaling pathway
    101134843 (MAPK11)
   04935 Growth hormone synthesis, secretion and action
    101134843 (MAPK11)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101134843 (MAPK11)
  09156 Nervous system
   04728 Dopaminergic synapse
    101134843 (MAPK11)
   04723 Retrograde endocannabinoid signaling
    101134843 (MAPK11)
   04722 Neurotrophin signaling pathway
    101134843 (MAPK11)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101134843 (MAPK11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101134843 (MAPK11)
  09159 Environmental adaptation
   04714 Thermogenesis
    101134843 (MAPK11)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101134843 (MAPK11)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101134843 (MAPK11)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101134843 (MAPK11)
   05020 Prion disease
    101134843 (MAPK11)
   05022 Pathways of neurodegeneration - multiple diseases
    101134843 (MAPK11)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101134843 (MAPK11)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101134843 (MAPK11)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101134843 (MAPK11)
   05135 Yersinia infection
    101134843 (MAPK11)
   05133 Pertussis
    101134843 (MAPK11)
   05152 Tuberculosis
    101134843 (MAPK11)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101134843 (MAPK11)
   05161 Hepatitis B
    101134843 (MAPK11)
   05171 Coronavirus disease - COVID-19
    101134843 (MAPK11)
   05163 Human cytomegalovirus infection
    101134843 (MAPK11)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101134843 (MAPK11)
   05169 Epstein-Barr virus infection
    101134843 (MAPK11)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101134843 (MAPK11)
   05140 Leishmaniasis
    101134843 (MAPK11)
   05142 Chagas disease
    101134843 (MAPK11)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101134843 (MAPK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101134843 (MAPK11)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101134843 (MAPK11)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101134843 (MAPK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Cas_CT1975 Kinase-like
Other DBs
NCBI-GeneID: 101134843
NCBI-ProteinID: XP_030863198
Ensembl: ENSGGOG00000027293
LinkDB
Position
Unknown
AA seq 364 aa
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGSDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSL
EIEQ
NT seq 1095 nt   +upstreamnt  +downstreamnt
atgtcgggccctcgcgccggcttctaccggcaggagctgaacaagaccgtgtgggaggtg
ccgcagcggctgcaggggctgcgcccggtgggctccggcgcctacggctccgtctgttcg
gcctacgacgcccggctgcgccagaaggtggcggtgaagaagctgtcgcgccccttccag
tcgctgatccacgcgcgcagaacgtaccgggagctgcggctgctcaagcacctgaagcac
gagaacgtcatcgggcttctggacgtcttcacgccggccacgtccatcgaggacttcagc
gaagtgtacttggtgaccaccctgatgggcgccgacctgaacaacatcgtcaagtgccag
gcgctgagcgacgagcacgttcaattcctggtttaccagctgctgcgcgggctgaagtac
atccactcggccgggatcatccaccgggacctgaagcccagcaacgtggctgtgaacgag
gactgtgagctcaggatcctggatttcgggctggcgcgccaggcggacgaggagatgacc
ggctatgtggccacgcgctggtaccgggcacctgagatcatgctcaactggatgcattac
aaccaaacagtggatatctggtccgtgggctgcatcatggctgagctgctccagggcaag
gccctcttcccgggaagcgactacattgaccagctgaagcgcatcatggaagtggtgggc
acacccagccctgaggttctggcaaaaatctcctcggaacacgcccggacatatatccag
tccctgccccccatgccccagaaggacctgagcagcatcttccgtggagccaaccccctg
gccatagacctccttggaaggatgctggtcctggacagtgaccagagggtcagtgcggct
gaggcactggcccatgcctacttcagccagtaccacgaccccgaggatgagccagaggca
gagccatatgatgagagcgttgaggccaaggagcgcacgctggaggagtggaaggagctc
acttaccaggaagtcctcagcttcaagcccccagagccaccgaagccacctggcagcctg
gagattgagcagtga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148438
Entry
101148438         CDS       T02442                                 

Gene name
MAPK13
Definition
(RefSeq) mitogen-activated protein kinase 13 isoform X3
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04015  Rap1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04114  Oocyte meiosis
ggo04218  Cellular senescence
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04370  VEGF signaling pathway
ggo04380  Osteoclast differentiation
ggo04550  Signaling pathways regulating pluripotency of stem cells
ggo04611  Platelet activation
ggo04613  Neutrophil extracellular trap formation
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04670  Leukocyte transendothelial migration
ggo04714  Thermogenesis
ggo04722  Neurotrophin signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04728  Dopaminergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04917  Prolactin signaling pathway
ggo04926  Relaxin signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04935  Growth hormone synthesis, secretion and action
ggo05014  Amyotrophic lateral sclerosis
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05135  Yersinia infection
ggo05140  Leishmaniasis
ggo05142  Chagas disease
ggo05145  Toxoplasmosis
ggo05152  Tuberculosis
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05171  Coronavirus disease - COVID-19
ggo05205  Proteoglycans in cancer
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101148438 (MAPK13)
   04015 Rap1 signaling pathway
    101148438 (MAPK13)
   04370 VEGF signaling pathway
    101148438 (MAPK13)
   04668 TNF signaling pathway
    101148438 (MAPK13)
   04068 FoxO signaling pathway
    101148438 (MAPK13)
   04071 Sphingolipid signaling pathway
    101148438 (MAPK13)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101148438 (MAPK13)
   04218 Cellular senescence
    101148438 (MAPK13)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101148438 (MAPK13)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101148438 (MAPK13)
   04613  Neutrophil extracellular trap formation
    101148438 (MAPK13)
   04620 Toll-like receptor signaling pathway
    101148438 (MAPK13)
   04621 NOD-like receptor signaling pathway
    101148438 (MAPK13)
   04622 RIG-I-like receptor signaling pathway
    101148438 (MAPK13)
   04625 C-type lectin receptor signaling pathway
    101148438 (MAPK13)
   04660 T cell receptor signaling pathway
    101148438 (MAPK13)
   04658 Th1 and Th2 cell differentiation
    101148438 (MAPK13)
   04659 Th17 cell differentiation
    101148438 (MAPK13)
   04657 IL-17 signaling pathway
    101148438 (MAPK13)
   04664 Fc epsilon RI signaling pathway
    101148438 (MAPK13)
   04670 Leukocyte transendothelial migration
    101148438 (MAPK13)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101148438 (MAPK13)
   04914 Progesterone-mediated oocyte maturation
    101148438 (MAPK13)
   04917 Prolactin signaling pathway
    101148438 (MAPK13)
   04926 Relaxin signaling pathway
    101148438 (MAPK13)
   04935 Growth hormone synthesis, secretion and action
    101148438 (MAPK13)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101148438 (MAPK13)
  09156 Nervous system
   04728 Dopaminergic synapse
    101148438 (MAPK13)
   04723 Retrograde endocannabinoid signaling
    101148438 (MAPK13)
   04722 Neurotrophin signaling pathway
    101148438 (MAPK13)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101148438 (MAPK13)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101148438 (MAPK13)
  09159 Environmental adaptation
   04714 Thermogenesis
    101148438 (MAPK13)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101148438 (MAPK13)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101148438 (MAPK13)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101148438 (MAPK13)
   05020 Prion disease
    101148438 (MAPK13)
   05022 Pathways of neurodegeneration - multiple diseases
    101148438 (MAPK13)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101148438 (MAPK13)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101148438 (MAPK13)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101148438 (MAPK13)
   05135 Yersinia infection
    101148438 (MAPK13)
   05133 Pertussis
    101148438 (MAPK13)
   05152 Tuberculosis
    101148438 (MAPK13)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101148438 (MAPK13)
   05161 Hepatitis B
    101148438 (MAPK13)
   05171 Coronavirus disease - COVID-19
    101148438 (MAPK13)
   05163 Human cytomegalovirus infection
    101148438 (MAPK13)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101148438 (MAPK13)
   05169 Epstein-Barr virus infection
    101148438 (MAPK13)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101148438 (MAPK13)
   05140 Leishmaniasis
    101148438 (MAPK13)
   05142 Chagas disease
    101148438 (MAPK13)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101148438 (MAPK13)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101148438 (MAPK13)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101148438 (MAPK13)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101148438 (MAPK13)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Kinase-like Kdo DUF4023 FTA2 DUF3231
Other DBs
NCBI-GeneID: 101148438
NCBI-ProteinID: XP_004043935
Ensembl: ENSGGOG00000003947
UniProt: G3QMX6
LinkDB
Position
6
AA seq 365 aa
MSLIRKKGFYKQDVNKTAWELPKTYVSPTHVGSGAYGSVCSAIDKRSGEKVAIKKLSRPF
QSEIFAKRAYRELLLLKHMQHENVIGLLDVFTPASSLRNFHDFYLVMPFMQTDLQKIMGM
EFSEEKIQYLVYQMLKGLKYIHSAGVVHRDLKPGNLAVNEDCELKILDFGLARHADAEMT
GYVVTRWYRAPEVILSWMHYNQTVDIWSVGCIMAEMLTGKTLFKGKDYLDQLTQILKVTG
VPGTEFVQKLNDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDKRLTAA
QALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRR
SGMKL
NT seq 1098 nt   +upstreamnt  +downstreamnt
atgagcctcatccggaaaaagggcttctacaagcaggacgtcaacaagaccgcctgggag
ctgcccaagacctacgtgtccccgacgcacgtcggcagcggggcctatggctccgtgtgc
tcggccatcgacaagcggtcaggggagaaggtggccatcaagaagctgagccgacccttt
cagtccgagatcttcgccaagcgcgcctaccgggagctgctgctgctgaagcacatgcag
catgagaacgtcatcgggctcctggatgtcttcaccccagcctcctccctgcgcaacttc
catgacttctacctggtgatgcccttcatgcagacggatctgcagaagatcatggggatg
gagttcagtgaggagaagatccagtacctggtgtatcagatgctcaaaggccttaagtac
atccactctgctggggtcgtgcacagggacctgaagccaggcaacctggctgtgaatgag
gactgtgaactgaagattctggattttgggctggcacgacatgcagacgccgagatgact
ggctacgtggtgacccgctggtaccgagcccccgaggtgatcctcagctggatgcactac
aaccagacagtggacatctggtctgtgggctgtatcatggcagagatgctgacagggaaa
actctgttcaaggggaaagattacctggaccagctgacccagatcctgaaagtgaccggg
gtgcctggcacggagtttgtgcagaagctgaacgacaaagcggccaaatcctacatccag
tccctgccacagacccccaggaaggatttcactcagctgttcccacgggccagcccccag
gctgcggacctgctggagaagatgctggagctagacgtggacaagcgcctgacggccgcg
caggccctcacccatcccttctttgaacccttccgggaccctgaggaagagacggaggcc
cagcagccgtttgatgattccttagaacacgagaaactcacagtggatgaatggaagcag
cacatctacaaggagattgtgaacttcagccccattgcccggaaggactcacggcgccgg
agtggcatgaagctgtag

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101152640
Entry
101152640         CDS       T02442                                 

Gene name
MAPK14
Definition
(RefSeq) mitogen-activated protein kinase 14 isoform X1
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04015  Rap1 signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04114  Oocyte meiosis
ggo04218  Cellular senescence
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04370  VEGF signaling pathway
ggo04380  Osteoclast differentiation
ggo04550  Signaling pathways regulating pluripotency of stem cells
ggo04611  Platelet activation
ggo04613  Neutrophil extracellular trap formation
ggo04620  Toll-like receptor signaling pathway
ggo04621  NOD-like receptor signaling pathway
ggo04622  RIG-I-like receptor signaling pathway
ggo04625  C-type lectin receptor signaling pathway
ggo04657  IL-17 signaling pathway
ggo04658  Th1 and Th2 cell differentiation
ggo04659  Th17 cell differentiation
ggo04660  T cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04668  TNF signaling pathway
ggo04670  Leukocyte transendothelial migration
ggo04714  Thermogenesis
ggo04722  Neurotrophin signaling pathway
ggo04723  Retrograde endocannabinoid signaling
ggo04728  Dopaminergic synapse
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04917  Prolactin signaling pathway
ggo04926  Relaxin signaling pathway
ggo04933  AGE-RAGE signaling pathway in diabetic complications
ggo04935  Growth hormone synthesis, secretion and action
ggo05014  Amyotrophic lateral sclerosis
ggo05020  Prion disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05132  Salmonella infection
ggo05133  Pertussis
ggo05135  Yersinia infection
ggo05140  Leishmaniasis
ggo05142  Chagas disease
ggo05145  Toxoplasmosis
ggo05152  Tuberculosis
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05169  Epstein-Barr virus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05171  Coronavirus disease - COVID-19
ggo05205  Proteoglycans in cancer
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ggo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101152640 (MAPK14)
   04015 Rap1 signaling pathway
    101152640 (MAPK14)
   04370 VEGF signaling pathway
    101152640 (MAPK14)
   04668 TNF signaling pathway
    101152640 (MAPK14)
   04068 FoxO signaling pathway
    101152640 (MAPK14)
   04071 Sphingolipid signaling pathway
    101152640 (MAPK14)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101152640 (MAPK14)
   04218 Cellular senescence
    101152640 (MAPK14)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    101152640 (MAPK14)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101152640 (MAPK14)
   04613  Neutrophil extracellular trap formation
    101152640 (MAPK14)
   04620 Toll-like receptor signaling pathway
    101152640 (MAPK14)
   04621 NOD-like receptor signaling pathway
    101152640 (MAPK14)
   04622 RIG-I-like receptor signaling pathway
    101152640 (MAPK14)
   04625 C-type lectin receptor signaling pathway
    101152640 (MAPK14)
   04660 T cell receptor signaling pathway
    101152640 (MAPK14)
   04658 Th1 and Th2 cell differentiation
    101152640 (MAPK14)
   04659 Th17 cell differentiation
    101152640 (MAPK14)
   04657 IL-17 signaling pathway
    101152640 (MAPK14)
   04664 Fc epsilon RI signaling pathway
    101152640 (MAPK14)
   04670 Leukocyte transendothelial migration
    101152640 (MAPK14)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101152640 (MAPK14)
   04914 Progesterone-mediated oocyte maturation
    101152640 (MAPK14)
   04917 Prolactin signaling pathway
    101152640 (MAPK14)
   04926 Relaxin signaling pathway
    101152640 (MAPK14)
   04935 Growth hormone synthesis, secretion and action
    101152640 (MAPK14)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101152640 (MAPK14)
  09156 Nervous system
   04728 Dopaminergic synapse
    101152640 (MAPK14)
   04723 Retrograde endocannabinoid signaling
    101152640 (MAPK14)
   04722 Neurotrophin signaling pathway
    101152640 (MAPK14)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101152640 (MAPK14)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101152640 (MAPK14)
  09159 Environmental adaptation
   04714 Thermogenesis
    101152640 (MAPK14)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101152640 (MAPK14)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101152640 (MAPK14)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    101152640 (MAPK14)
   05020 Prion disease
    101152640 (MAPK14)
   05022 Pathways of neurodegeneration - multiple diseases
    101152640 (MAPK14)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101152640 (MAPK14)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101152640 (MAPK14)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101152640 (MAPK14)
   05135 Yersinia infection
    101152640 (MAPK14)
   05133 Pertussis
    101152640 (MAPK14)
   05152 Tuberculosis
    101152640 (MAPK14)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101152640 (MAPK14)
   05161 Hepatitis B
    101152640 (MAPK14)
   05171 Coronavirus disease - COVID-19
    101152640 (MAPK14)
   05163 Human cytomegalovirus infection
    101152640 (MAPK14)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101152640 (MAPK14)
   05169 Epstein-Barr virus infection
    101152640 (MAPK14)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101152640 (MAPK14)
   05140 Leishmaniasis
    101152640 (MAPK14)
   05142 Chagas disease
    101152640 (MAPK14)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101152640 (MAPK14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101152640 (MAPK14)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101152640 (MAPK14)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   101152640 (MAPK14)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH NAD_binding_8 Kinase-like
Other DBs
NCBI-GeneID: 101152640
NCBI-ProteinID: XP_030867964
LinkDB
Position
6
AA seq 360 aa
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgtctcaggagaggcccacgttctaccggcaggagctgaacaagacaatctgggaggtg
cccgagcgttaccagaacctgtctccagtgggctctggcgcctatggctctgtgtgtgct
gcttttgacacaaaaacggggttacgtgtggcagtgaagaagctctccagaccatttcag
tccatcattcatgcgaaaagaacctacagagaactgcggttacttaaacatatgaaacat
gaaaatgtgattggtctgttggacgtttttacacctgcaaggtctctggaggaattcaat
gatgtgtatctggtgacccatctcatgggggcagatctgaacaacattgtgaaatgtcag
aagcttacagatgaccatgttcagttccttatctaccaaattctccgaggtctaaagtat
atacattcagctgacataattcacagggacctaaaacctagtaatctagctgtgaatgaa
gactgtgagctgaagattctggattttggactggctcggcacacagatgatgaaatgaca
ggctacgtggccactaggtggtatagggctcctgagatcatgctgaactggatgcattac
aaccagacagttgatatttggtcagtgggatgcataatggccgagctgttgactggaaga
acattgtttcctggtacagaccatattgatcagttgaagctcattttaagactcgttgga
accccaggggctgagcttttgaagaaaatctcctcagagtctgcaagaaactatattcag
tctttgactcagatgccgaagatgaactttgcgaatgtatttattggtgccaatcccctg
gctgtcgacttgctggagaagatgcttgtattggactcagataagagaattacagcggcc
caagcccttgcacatgcctactttgctcagtaccacgatcctgatgatgaaccagtggcc
gatccttatgatcagtcctttgaaagcagggacctccttatagatgagtggaaaagcctg
acctatgatgaagtcatcagctttgtgccaccaccccttgaccaagaagagatggagtcc
tga

DBGET integrated database retrieval system