KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134676
Entry
101134676         CDS       T02442                                 

Gene name
CAMK2D
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit delta isoform X29
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04012  ErbB signaling pathway
ggo04020  Calcium signaling pathway
ggo04024  cAMP signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04114  Oocyte meiosis
ggo04217  Necroptosis
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04310  Wnt signaling pathway
ggo04360  Axon guidance
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04722  Neurotrophin signaling pathway
ggo04725  Cholinergic synapse
ggo04728  Dopaminergic synapse
ggo04740  Olfactory transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04916  Melanogenesis
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04925  Aldosterone synthesis and secretion
ggo04934  Cushing syndrome
ggo04971  Gastric acid secretion
ggo05012  Parkinson disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05031  Amphetamine addiction
ggo05152  Tuberculosis
ggo05200  Pathways in cancer
ggo05205  Proteoglycans in cancer
ggo05214  Glioma
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101134676 (CAMK2D)
   04310 Wnt signaling pathway
    101134676 (CAMK2D)
   04066 HIF-1 signaling pathway
    101134676 (CAMK2D)
   04020 Calcium signaling pathway
    101134676 (CAMK2D)
   04024 cAMP signaling pathway
    101134676 (CAMK2D)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101134676 (CAMK2D)
   04217 Necroptosis
    101134676 (CAMK2D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101134676 (CAMK2D)
   04922 Glucagon signaling pathway
    101134676 (CAMK2D)
   04912 GnRH signaling pathway
    101134676 (CAMK2D)
   04921 Oxytocin signaling pathway
    101134676 (CAMK2D)
   04916 Melanogenesis
    101134676 (CAMK2D)
   04925 Aldosterone synthesis and secretion
    101134676 (CAMK2D)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101134676 (CAMK2D)
  09154 Digestive system
   04971 Gastric acid secretion
    101134676 (CAMK2D)
  09156 Nervous system
   04725 Cholinergic synapse
    101134676 (CAMK2D)
   04728 Dopaminergic synapse
    101134676 (CAMK2D)
   04720 Long-term potentiation
    101134676 (CAMK2D)
   04722 Neurotrophin signaling pathway
    101134676 (CAMK2D)
  09157 Sensory system
   04740 Olfactory transduction
    101134676 (CAMK2D)
   04750 Inflammatory mediator regulation of TRP channels
    101134676 (CAMK2D)
  09158 Development and regeneration
   04360 Axon guidance
    101134676 (CAMK2D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101134676 (CAMK2D)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101134676 (CAMK2D)
   05205 Proteoglycans in cancer
    101134676 (CAMK2D)
  09162 Cancer: specific types
   05214 Glioma
    101134676 (CAMK2D)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101134676 (CAMK2D)
   05022 Pathways of neurodegeneration - multiple diseases
    101134676 (CAMK2D)
  09165 Substance dependence
   05031 Amphetamine addiction
    101134676 (CAMK2D)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101134676 (CAMK2D)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101134676 (CAMK2D)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101134676 (CAMK2D)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101134676 (CAMK2D)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101134676 (CAMK2D)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 Pkinase_fungal Kdo SnoaL_2 SnoaL_4 DUF4915
Other DBs
NCBI-GeneID: 101134676
NCBI-ProteinID: XP_004040351
Ensembl: ENSGGOG00000022729
UniProt: A0A2I2YPU1
LinkDB
Position
4
AA seq 478 aa
MASTTTCTRFTDEYQLFEELGKGAFSVVRRCMKIPTGQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LESVNHCHLNGIVHRDLKPENLLLASKSKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDMWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDT
VTPEAKDLINKMLTINPAKRITASEALKHPWICQRSTVASMMHRQETVDCLKKFNARRKL
KGAILTTMLATRNFSAAKSLLKKPDGVKESTESSNTTIEDEDVKARKQEIIKVTEQLIEA
INNGDFEAYTKICDPGLTAFEPEALGNLVEGMDFHRFYFENALSKSNKPIHTIILNPHVH
LVGDDAACIAYIRLTQYMDGSGMPKTMQSEETRVWHRRDGKWQNVHFHRSGSPTVPIN
NT seq 1437 nt   +upstreamnt  +downstreamnt
atggcttcgaccacaacctgcaccaggttcacggacgagtatcagcttttcgaggagctt
ggaaagggggcattctcagtggtgagaagatgtatgaaaattcctactggacaagaatat
gctgccaaaattatcaacaccaaaaagctttctgctagggatcatcagaaactagaaaga
gaagctagaatctgccgtcttttgaagcaccctaatattgtgcgacttcatgatagcata
tcagaagagggctttcactacttggtgtttgatttagttactggaggtgaactgtttgaa
gacatagtggcaagagaatactacagtgaagctgatgccagtcattgtatacagcagatt
ctagaaagtgtaaatcattgtcacctaaatggcatagttcacagggacctgaagcctgag
aatttgcttttagctagcaaatccaagggagcagctgtgaaattggcagactttggctta
gccatagaagttcaaggggaccagcaggcgtggtttggttttgctggcacacctggatat
ctttctccagaagttttacgtaaagatccttatggaaagccagtggatatgtgggcatgt
ggtgtcattctctatattctacttgtggggtatccacccttctgggatgaagaccaacac
agactctatcagcagatcaaggctggagcttatgattttccatcaccagaatgggacacg
gtgactcctgaagccaaagacctcatcaataaaatgcttactatcaaccctgccaaacgt
atcacagcctcagaggcactgaagcacccatggatctgtcaacgttctactgttgcttcc
atgatgcacagacaggagactgtagactgcttgaagaaatttaatgctagaagaaaacta
aagggtgccatcttgacaactatgctggctacaaggaatttctcagcagccaagagtttg
ttgaagaaaccagatggagtaaaggagtcaactgagagttcaaatacaacaattgaggat
gaagatgtgaaagcacgaaagcaagagattatcaaagtcactgaacaactgatcgaagct
atcaacaatggggactttgaagcctacacaaaaatctgtgacccaggccttactgctttt
gaacctgaagctttgggtaatttagtggaagggatggattttcaccgattctactttgaa
aatgctttgtccaaaagcaataaaccaatccacactattattctaaaccctcatgtacat
ctggtaggggatgatgccgcctgcatagcatatattaggctcacacagtacatggatggc
agtggaatgccaaagacaatgcagtcagaagagactcgtgtgtggcaccgccgggatgga
aagtggcagaatgttcattttcatcgctcggggtcaccaacagtacccatcaactaa

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136547
Entry
101136547         CDS       T02442                                 

Gene name
CAMK2G
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit gamma isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04012  ErbB signaling pathway
ggo04020  Calcium signaling pathway
ggo04024  cAMP signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04114  Oocyte meiosis
ggo04217  Necroptosis
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04310  Wnt signaling pathway
ggo04360  Axon guidance
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04722  Neurotrophin signaling pathway
ggo04725  Cholinergic synapse
ggo04728  Dopaminergic synapse
ggo04740  Olfactory transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04916  Melanogenesis
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04925  Aldosterone synthesis and secretion
ggo04934  Cushing syndrome
ggo04971  Gastric acid secretion
ggo05012  Parkinson disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05031  Amphetamine addiction
ggo05152  Tuberculosis
ggo05200  Pathways in cancer
ggo05205  Proteoglycans in cancer
ggo05214  Glioma
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101136547 (CAMK2G)
   04310 Wnt signaling pathway
    101136547 (CAMK2G)
   04066 HIF-1 signaling pathway
    101136547 (CAMK2G)
   04020 Calcium signaling pathway
    101136547 (CAMK2G)
   04024 cAMP signaling pathway
    101136547 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101136547 (CAMK2G)
   04217 Necroptosis
    101136547 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101136547 (CAMK2G)
   04922 Glucagon signaling pathway
    101136547 (CAMK2G)
   04912 GnRH signaling pathway
    101136547 (CAMK2G)
   04921 Oxytocin signaling pathway
    101136547 (CAMK2G)
   04916 Melanogenesis
    101136547 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    101136547 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101136547 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    101136547 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    101136547 (CAMK2G)
   04728 Dopaminergic synapse
    101136547 (CAMK2G)
   04720 Long-term potentiation
    101136547 (CAMK2G)
   04722 Neurotrophin signaling pathway
    101136547 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    101136547 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    101136547 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    101136547 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101136547 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101136547 (CAMK2G)
   05205 Proteoglycans in cancer
    101136547 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    101136547 (CAMK2G)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101136547 (CAMK2G)
   05022 Pathways of neurodegeneration - multiple diseases
    101136547 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    101136547 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101136547 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101136547 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101136547 (CAMK2G)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101136547 (CAMK2G)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101136547 (CAMK2G)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr CaMKII_AD APH Pkinase_fungal Kdo RIO1
Other DBs
NCBI-GeneID: 101136547
NCBI-ProteinID: XP_030870935
Ensembl: ENSGGOG00000006223
LinkDB
Position
10
AA seq 592 aa
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKKRKSSSSVH
LMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKAAPLRIGNGSSVPEGRSSRDRTAPSAG
MQPQPSLCSSAMRKQEIIKITEQLIEAINNGDFEAYTKICDPGLTSFEPEALGNLVEGMD
FHKFYFENREWVRAADILLPAPSPLCLCLLLTFSSQLPTFPLFDLRAALLLCMLVPLCPD
GCRQAPLKALLLSSKCHSFCSCLVAVPVTTIKLTYFLPGAVAYACNPSTLGS
NT seq 1779 nt   +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgcttcaccgacgactaccagctcttcgaggagctt
ggcaagggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaggagtac
gcagcaaaaatcatcaataccaagaagttgtctgcccgggatcaccagaaactagaacgt
gaggctcggatatgtcgacttctgaaacatccaaacatcgtgcgcctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttaccggcggggagctgtttgaa
gacattgtggccagagagtactacagtgaagcagatgccagccactgtatacatcagatt
ctggagagtgttaaccacatccaccagcatgacatcgtccacagggacctgaagcctgag
aacctgctgctggcgagtaaatgcaagggtgccgccgtcaagctggctgattttggccta
gccatcgaagtacagggagagcagcaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggggtcatcctgtatatcctcctggtgggctatcctcccttctgggatgaggatcagcac
aagctgtatcagcagatcaaggctggagcctatgatttcccatcaccagaatgggacacg
gtaactcctgaagccaagaacttgatcaaccagatgctgaccataaacccagcaaagcgc
atcacggctgaccaggctctcaagcacccgtgggtctgtcaacgatccacggtggcatcc
atgatgcatcgtcaggagactgtggagtgtttgcgcaagttcaatgcccggagaaaactg
aagggtgccatcctcacgaccatgcttgtctccaggaacttctcagttggcaggcagagc
tccgcccccgcctcgcctgccgcgagcgccgccggcctggccgggcaagctgccaaaagc
ctattgaacaagaagtcggatggcggtgtcaagaaaaggaagtcgagttccagcgtgcac
ctaatggagccacaaaccactgtggtacacaacgctacagatgggatcaagggctccaca
gagagctgcaacaccaccacagaagatgaggacctcaaagctgccccgctccgcattggg
aatggcagctcggtgcctgaaggacggagctcccgggacagaacagccccctctgcaggc
atgcagccccagccttctctctgctcctcagccatgcgaaaacaggagatcattaagatt
acagaacagctgattgaagccatcaacaatggggactttgaggcctacacgaagatttgt
gatccaggcctcacttcctttgagcctgaggcccttggtaacctcgtggaggggatggat
ttccataagttttactttgagaaccgtgagtgggttcgtgctgctgatatactcctgcct
gccccttcacccctttgtctctgtctcctgctcaccttctcatcccagttgcccactttt
cccttatttgaccttcgtgctgcactcctactctgtatgcttgtccccttgtgccccgat
ggttgtagacaggcacctttgaaggccctgctcctgagctccaagtgccattcgttctgc
agctgccttgtggcagtgccagtcaccacaatcaagctcacttatttcttgccgggcgcg
gtggcttacgcctgtaatcccagcactttgggaagctga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101148194
Entry
101148194         CDS       T02442                                 

Gene name
CAMK2B
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit beta isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04012  ErbB signaling pathway
ggo04020  Calcium signaling pathway
ggo04024  cAMP signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04114  Oocyte meiosis
ggo04217  Necroptosis
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04310  Wnt signaling pathway
ggo04360  Axon guidance
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04722  Neurotrophin signaling pathway
ggo04725  Cholinergic synapse
ggo04728  Dopaminergic synapse
ggo04740  Olfactory transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04916  Melanogenesis
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04925  Aldosterone synthesis and secretion
ggo04934  Cushing syndrome
ggo04971  Gastric acid secretion
ggo05012  Parkinson disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05031  Amphetamine addiction
ggo05152  Tuberculosis
ggo05200  Pathways in cancer
ggo05205  Proteoglycans in cancer
ggo05214  Glioma
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101148194 (CAMK2B)
   04310 Wnt signaling pathway
    101148194 (CAMK2B)
   04066 HIF-1 signaling pathway
    101148194 (CAMK2B)
   04020 Calcium signaling pathway
    101148194 (CAMK2B)
   04024 cAMP signaling pathway
    101148194 (CAMK2B)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101148194 (CAMK2B)
   04217 Necroptosis
    101148194 (CAMK2B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101148194 (CAMK2B)
   04922 Glucagon signaling pathway
    101148194 (CAMK2B)
   04912 GnRH signaling pathway
    101148194 (CAMK2B)
   04921 Oxytocin signaling pathway
    101148194 (CAMK2B)
   04916 Melanogenesis
    101148194 (CAMK2B)
   04925 Aldosterone synthesis and secretion
    101148194 (CAMK2B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101148194 (CAMK2B)
  09154 Digestive system
   04971 Gastric acid secretion
    101148194 (CAMK2B)
  09156 Nervous system
   04725 Cholinergic synapse
    101148194 (CAMK2B)
   04728 Dopaminergic synapse
    101148194 (CAMK2B)
   04720 Long-term potentiation
    101148194 (CAMK2B)
   04722 Neurotrophin signaling pathway
    101148194 (CAMK2B)
  09157 Sensory system
   04740 Olfactory transduction
    101148194 (CAMK2B)
   04750 Inflammatory mediator regulation of TRP channels
    101148194 (CAMK2B)
  09158 Development and regeneration
   04360 Axon guidance
    101148194 (CAMK2B)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101148194 (CAMK2B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101148194 (CAMK2B)
   05205 Proteoglycans in cancer
    101148194 (CAMK2B)
  09162 Cancer: specific types
   05214 Glioma
    101148194 (CAMK2B)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101148194 (CAMK2B)
   05022 Pathways of neurodegeneration - multiple diseases
    101148194 (CAMK2B)
  09165 Substance dependence
   05031 Amphetamine addiction
    101148194 (CAMK2B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101148194 (CAMK2B)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101148194 (CAMK2B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101148194 (CAMK2B)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101148194 (CAMK2B)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101148194 (CAMK2B)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr DUF4440 SnoaL_3 SnoaL_2 APH Kdo Pkinase_fungal SnoaL_4
Other DBs
NCBI-GeneID: 101148194
NCBI-ProteinID: XP_030869204
LinkDB
Position
7
AA seq 666 aa
MATTVTCTRFTDEYQLYEDIGKGAFSVVRRCVKLCTGHEYAAKIINTKKLSARDHQKLER
EARICRLLKHSNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIQQI
LEAVLHCHQMGVVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGDQQAWFGFAGTPGY
LSPEVLRKEAYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITAHEALKHPWVCQRSTVASMMHRQETVECLKKFNARRKL
KGAILTTMLATRNFSVGRQTTAPATMSTAASGTTMGLVEQAKSLLNKKADGVKPQTNSTK
NSAAATSPKGTLPPAALEPQTTVIHNPVDGIKESSDSANTTIEDEDAKAPRVPDILSSVR
RGSGAPEAEGPLPCPSPAPFSPLPAPSPRISDILNSVRRGSGTPEAEGPLSAGPPPCLSP
ALLGPLSSPSPRISDILNSVRRGSGTPEAEGPSPVGPPPCLSPTIPGPLPTPSRKQEIIK
TTEQLIEAVNNGDFEAYAKICDPGLTSFEPEALGNLVEGMDFHRFYFENLLAKNSKPIHT
TILNPHVHVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWQNVHFHCSGA
PVAPLQ
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggccaccacggtgacctgcacccgcttcaccgacgagtaccagctctacgaggatatt
ggcaagggggctttctctgtggtccgacgctgtgtcaagctctgcaccggccatgagtat
gcagccaagatcatcaacaccaagaagctgtcagccagagatcaccagaagctggagaga
gaggctcggatctgccgccttctgaagcattccaacatcgtgcgtctccacgacagcatc
tccgaggagggcttccactacctggtcttcgatctggtcactggtggggagctctttgaa
gacattgtggcgagagagtactacagcgaggctgatgccagtcactgtatccagcagatc
ctggaggccgttctccattgtcaccaaatgggggtcgtccacagagacctcaagccggag
aacctgctcctggccagcaagtgcaaaggggctgcagtgaagctggcagacttcggccta
gctatcgaggtgcagggggaccagcaggcatggtttgggtttgctggcacaccaggctac
ctgtcccctgaggtccttcgcaaagaggcgtatggcaagcccgtggacatctgggcatgt
ggggtgatcctgtacatcctgctcgtgggctacccacccttctgggacgaggaccagcac
aagctgtaccagcagatcaaggctggtgcctatgacttcccatcccctgagtgggacacc
gtcactcctgaagccaaaaacctcatcaaccagatgctgaccatcaaccctgccaagcgc
atcacagcccatgaggccctgaagcacccgtgggtctgccaacgctccacggtagcatcc
atgatgcacagacaggagactgtggagtgtctgaaaaagttcaatgccaggagaaagctc
aagggagccatcctcaccaccatgctggccacacggaatttctcagtgggcagacagacc
accgctccggccacaatgtccaccgcggcctccggcaccaccatggggctggtggaacaa
gccaagagtttactcaacaagaaagcagatggagtcaagccccagacgaatagcaccaaa
aacagtgcagccgccaccagccccaaagggacgcttcctcctgccgccctggagcctcaa
accaccgtcatccataacccagtggacgggattaaggagtcttctgacagtgccaatacc
accatagaggatgaagacgctaaagcccccagggtccccgacatcctgagctcagtgagg
aggggctcgggagccccagaagccgaggggcccctgccctgcccatctccggctcccttt
agccccctgccagccccatcccccaggatctctgacatcctgaactctgtgagaaggggt
tcaggaaccccagaagccgagggccccctctcagcggggcccccgccctgcctgtctccg
gctctcctaggccccctgtcctccccgtcccccaggatctctgacatcctgaactctgtg
aggaggggctcagggaccccagaagccgagggcccctcgccagtggggcccccgccctgc
ctatctccgactatccctggccccctgcccaccccatcccggaagcaggagatcattaag
accacggagcagctcatcgaggccgtcaacaacggtgactttgaggcctacgcgaaaatc
tgtgacccagggctgacctcgtttgagcctgaagcactgggcaacctggttgaagggatg
gacttccacagattctacttcgagaacctgctggccaagaacagcaagccgatccacacg
accatcctgaacccacacgtgcacgtcatcggagaggatgccgcctgcatcgcttacatc
cggctcacgcagtacattgacgggcagggccggccccgcaccagccagtctgaggagacc
cgcgtgtggcaccgccgcgacggcaagtggcagaacgtgcacttccactgctcgggcgcg
cctgtggccccgctgcagtga

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101153594
Entry
101153594         CDS       T02442                                 

Gene name
CAMK2A
Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type II subunit alpha isoform X1
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04012  ErbB signaling pathway
ggo04020  Calcium signaling pathway
ggo04024  cAMP signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04114  Oocyte meiosis
ggo04217  Necroptosis
ggo04261  Adrenergic signaling in cardiomyocytes
ggo04310  Wnt signaling pathway
ggo04360  Axon guidance
ggo04713  Circadian entrainment
ggo04720  Long-term potentiation
ggo04722  Neurotrophin signaling pathway
ggo04725  Cholinergic synapse
ggo04728  Dopaminergic synapse
ggo04740  Olfactory transduction
ggo04750  Inflammatory mediator regulation of TRP channels
ggo04911  Insulin secretion
ggo04912  GnRH signaling pathway
ggo04916  Melanogenesis
ggo04921  Oxytocin signaling pathway
ggo04922  Glucagon signaling pathway
ggo04925  Aldosterone synthesis and secretion
ggo04934  Cushing syndrome
ggo04971  Gastric acid secretion
ggo05012  Parkinson disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05031  Amphetamine addiction
ggo05152  Tuberculosis
ggo05200  Pathways in cancer
ggo05205  Proteoglycans in cancer
ggo05214  Glioma
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101153594 (CAMK2A)
   04310 Wnt signaling pathway
    101153594 (CAMK2A)
   04066 HIF-1 signaling pathway
    101153594 (CAMK2A)
   04020 Calcium signaling pathway
    101153594 (CAMK2A)
   04024 cAMP signaling pathway
    101153594 (CAMK2A)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101153594 (CAMK2A)
   04217 Necroptosis
    101153594 (CAMK2A)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101153594 (CAMK2A)
   04922 Glucagon signaling pathway
    101153594 (CAMK2A)
   04912 GnRH signaling pathway
    101153594 (CAMK2A)
   04921 Oxytocin signaling pathway
    101153594 (CAMK2A)
   04916 Melanogenesis
    101153594 (CAMK2A)
   04925 Aldosterone synthesis and secretion
    101153594 (CAMK2A)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101153594 (CAMK2A)
  09154 Digestive system
   04971 Gastric acid secretion
    101153594 (CAMK2A)
  09156 Nervous system
   04725 Cholinergic synapse
    101153594 (CAMK2A)
   04728 Dopaminergic synapse
    101153594 (CAMK2A)
   04720 Long-term potentiation
    101153594 (CAMK2A)
   04722 Neurotrophin signaling pathway
    101153594 (CAMK2A)
  09157 Sensory system
   04740 Olfactory transduction
    101153594 (CAMK2A)
   04750 Inflammatory mediator regulation of TRP channels
    101153594 (CAMK2A)
  09158 Development and regeneration
   04360 Axon guidance
    101153594 (CAMK2A)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101153594 (CAMK2A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101153594 (CAMK2A)
   05205 Proteoglycans in cancer
    101153594 (CAMK2A)
  09162 Cancer: specific types
   05214 Glioma
    101153594 (CAMK2A)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101153594 (CAMK2A)
   05022 Pathways of neurodegeneration - multiple diseases
    101153594 (CAMK2A)
  09165 Substance dependence
   05031 Amphetamine addiction
    101153594 (CAMK2A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101153594 (CAMK2A)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101153594 (CAMK2A)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ggo01001]
    101153594 (CAMK2A)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101153594 (CAMK2A)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   101153594 (CAMK2A)
SSDB
Motif
Pfam: Pkinase CaMKII_AD PK_Tyr_Ser-Thr SnoaL_3 DUF4440 APH Kdo SnoaL_2 SnoaL_4
Other DBs
NCBI-GeneID: 101153594
NCBI-ProteinID: XP_004042857
Ensembl: ENSGGOG00000000108
UniProt: A0A2I2Y6I6
LinkDB
Position
5
AA seq 489 aa
MATITCTRFTEEYQLFEELGKGAFSVVRRCVKVLAGQEYAAKIINTKKLSARDHQKLERE
ARICRLLKHPNIVRLHDSISEEGHHYLIFDLVTGGELFEDIVAREYYSEADASHCIQQIL
EAVLHCHQMGVVHRDLKPENLLLASKLKGAAVKLADFGLAIEVEGEQQAWFGFAGTPGYL
SPEVLRKDPYGKPVDLWACGVILYILLVGYPPFWDEDQHRLYQQIKAGAYDFPSPEWDTV
TPEAKDLINKMLTINPSKRITAAEALKHPWISHRSTVASCMHRQETVDCLKKFNARRKLK
GAILTTMLATRNFSGGKSGGNKKSDGVKKRKSSSSVQLMESSESTNTTIEDEDTKVRKQE
IIKVTEQLIEAISNGDFESYTKMCDPGMTAFEPEALGNLVEGLDFHRFYFENLWSRNSKP
VHTTILNPHIHLMGDESACIAYIRITQYLDAGGIPRTAQSEETRVWHRRDGKWQIVHFHR
SGAPSVLPH
NT seq 1470 nt   +upstreamnt  +downstreamnt
atggccaccatcacctgcacccgcttcacggaagagtaccagctcttcgaggaattgggc
aagggagccttctcggtggtgcgaaggtgtgtgaaggtgctggccggccaggagtatgct
gccaagatcatcaacacaaagaagctgtcagccagagaccatcagaagctggagcgtgaa
gcccgcatctgtcgcctgctgaagcaccccaacatcgtccgactacatgacagcatctca
gaggagggacaccactacctgatcttcgacctggtcactggtggggaactgtttgaagat
atcgtggcccgggagtattacagtgaggcggatgccagtcactgtatccagcagatcctg
gaggctgtgctgcactgccaccagatgggggtggtgcaccgggacctgaagcctgagaat
ctgttgctggcctccaagctcaagggtgccgcagtgaagctggcagactttggcctggcc
atagaggtggagggggagcagcaggcatggtttgggtttgcagggactcctggatacctc
tccccagaagtgctgcggaaggacccgtacgggaagcctgtggacctgtgggcttgtggg
gtcatcctgtacatcctgctggttgggtaccccccgttctgggatgaggaccagcaccgc
ctgtaccagcagatcaaagccggcgcctatgatttcccatctccggaatgggacactgtc
accccggaagccaaggatctgatcaataagatgctgaccattaacccatccaaacgcatc
acagctgccgaagcccttaagcacccctggatctcgcaccgctccaccgtggcatcctgc
atgcacagacaggagaccgtggactgcctgaagaagttcaatgccaggaggaaactgaag
ggagccattctcaccacgatgctggccaccaggaacttctccggagggaagagtggggga
aacaagaagagcgatggtgtgaagaaaagaaagtccagttccagcgttcagttaatggaa
tcctcagagagcaccaacactaccatcgaggatgaagacaccaaagtgcggaaacaggaa
attataaaagtgacagagcagctgattgaagccataagcaatggagattttgagtcctac
acgaagatgtgcgaccctggcatgacagccttcgaacctgaggccctgggaaacctggtt
gagggcctggacttccatcgattctattttgaaaacctgtggtcccggaacagcaagccc
gtgcacaccaccatcctgaatccccacatccacctgatgggcgacgagtcagcctgcatc
gcctacatccgcatcacgcagtacctggacgctggcggcatcccacgcaccgcccagtcg
gaggagacccgtgtctggcaccgccgggacggcaaatggcagatcgtccacttccacaga
tctggggcgccctccgtcctgccccactga

DBGET integrated database retrieval system