KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101134923
Entry
101134923         CDS       T02442                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00220  Arginine biosynthesis
ggo00330  Arginine and proline metabolism
ggo01100  Metabolic pathways
ggo04020  Calcium signaling pathway
ggo04066  HIF-1 signaling pathway
ggo04146  Peroxisome
ggo04371  Apelin signaling pathway
ggo04926  Relaxin signaling pathway
ggo05010  Alzheimer disease
ggo05014  Amyotrophic lateral sclerosis
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05133  Pertussis
ggo05140  Leishmaniasis
ggo05142  Chagas disease
ggo05145  Toxoplasmosis
ggo05146  Amoebiasis
ggo05152  Tuberculosis
ggo05200  Pathways in cancer
ggo05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101134923 (NOS2)
   00330 Arginine and proline metabolism
    101134923 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101134923 (NOS2)
   04066 HIF-1 signaling pathway
    101134923 (NOS2)
   04020 Calcium signaling pathway
    101134923 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101134923 (NOS2)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    101134923 (NOS2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101134923 (NOS2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    101134923 (NOS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101134923 (NOS2)
   05014 Amyotrophic lateral sclerosis
    101134923 (NOS2)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101134923 (NOS2)
   05152 Tuberculosis
    101134923 (NOS2)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    101134923 (NOS2)
   05145 Toxoplasmosis
    101134923 (NOS2)
   05140 Leishmaniasis
    101134923 (NOS2)
   05142 Chagas disease
    101134923 (NOS2)
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101134923 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 101134923
NCBI-ProteinID: XP_018883950
Ensembl: ENSGGOG00000000820
UniProt: G3RR01
LinkDB
Position
5
AA seq 1153 aa
MACPWKFLFKTKFHQYAMNGEKDINNNVEKAPCATSSPVTQDDLQYHNLSKQQNESPQPL
VETGKKSPESLVKLDATPLSSPRHVRIKNWGSGMTFQDTLHHKAKGILTCRSKSCLGSIM
TPKSLTRGPRDKPTPPDELLPQAIEFVNQYYGSFKEAKIEEHLARVEAVTKEIETTGTYQ
LTGDELIFATKQAWRNAPRCIGRIQWSNLQVFDARSCSTAREMFEHICRHVRYSTNNGNI
RSAITVFPQRSDGKHDFRVWNAQLIRYAGYQMPDGSIRGDPANVEFTQLCIDLGWKPKYG
RFDVVPLVLQANGRDPELFEIPPDLVLEVAMEHPKYEWFRELELKWYALPAVANMLLEVG
GLEFPGCPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRMGLETHKLASLWKDQAVVEINI
AVLHSFQKQNVTIMDHHSAAESFMKYMQNEYRSRGGCPADWIWLVPPMSGSITPVFHQEM
LNYVLSPFYYYQVEAWKTHVWQDEKRRPKRKEIPLKVLVKAVLFACMLMRKTMASRVRVT
ILFATETGKSEALAWDLGALFSCAFNPKVVCMDNYRLSCLEEERLLLVVTSTFGNGDCPG
NGEKLKKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHLGASQLTPMGEGD
ELSGQEDAFRSWAVQTFKAACETFDVRGKQHIQIPKLYTSNVTWDPHHYRLVQDSQPLDL
SKALSSMHAKNVFTMRLKSRQNLQSPTSSRATILVELSCEDGPGLNYLPGEHLGVCPGNQ
PALVQGILERVVDGPTPHQTVRLEALDESGSYWVSDKRLPPCSLSQALTYFLDITTPPTQ
LLLQKLAQVATEATERQRLEALCQPSEYSKWKFTNSPTFLEVLEEFPSLRVSAGFLLSQL
PILKPRFYSISSSRDHTPTEIHLTVAVVTYHTRDGQGPLHHGVCSTWLNSLKPQDPVPCF
VRNASGFHLPEDPSHPCILIGPGTGIAPFRSFWQQRLHDSQHKGVRGGRMTLVFGCRRPD
EDHIYQEEMLEMAQKGVLHEVHTAYSRLPGKPKVYVQDILRQQLASEVLRVLHKEPGHLY
VCGDVRMARDVAHTLKQLVAANLKLNEEQVEDYFFQLKSQKRYHEDIFGAVFPYEAKKDR
AAVQPSSLEMSVL
NT seq 3462 nt   +upstreamnt  +downstreamnt
atggcctgtccttggaaatttctgttcaagaccaaattccaccagtatgcaatgaatggg
gaaaaagacatcaacaacaatgtggagaaagccccctgtgccacctccagtccagtgaca
caggatgaccttcagtatcacaacctcagcaagcagcagaatgagtccccgcagcccctc
gtggagacgggaaagaagtctccagaatctctggtcaagctggatgcaaccccattgtcc
tccccacggcatgtgaggatcaaaaactggggcagcgggatgactttccaagacacactt
caccataaggccaaagggattttaacttgcaggtccaaatcttgcctggggtccattatg
actcccaaaagcttgaccagaggacccagggacaagcctacccctccagatgagcttcta
cctcaagctatcgaatttgtcaaccaatattacggctccttcaaagaggcaaaaatagag
gaacatctggccagggtggaagcggtaacaaaggagatagaaacaacaggaacctaccaa
ctgacgggagatgagctcatcttcgccaccaagcaggcctggcgcaatgccccacgctgc
attgggaggatccagtggtccaacctgcaggtcttcgatgcccgcagctgttccaccgcc
cgggaaatgtttgaacacatctgcagacacgtgcgttactccaccaacaatggcaacatc
aggtcggccatcaccgtgttcccccagcggagtgatggcaagcacgacttccgggtgtgg
aatgctcagctcatccgctatgctggctaccagatgccagatggcagcatcagaggggac
cctgccaacgtggaattcactcagctgtgcatcgacctgggctggaagcccaagtacggc
cgcttcgatgtggtccccctggtcctgcaggccaatggccgtgaccctgagctcttcgaa
atcccacctgaccttgtgcttgaggtggccatggaacatcccaaatacgagtggtttcgg
gaactggagctaaagtggtacgccctgcctgcagtggccaacatgctgcttgaggtgggc
ggcctggagttcccagggtgccccttcaatggctggtacatgggcacagagatcggagtc
cgggacttctgtgacgtccagcgctacaacatcctggaggaagtgggcaggagaatgggc
ttggaaacgcacaagctggcctcgctctggaaagaccaggctgtcgttgaaatcaacatt
gctgtgctccatagtttccagaagcagaatgtgaccatcatggaccaccactcggctgca
gaatccttcatgaagtatatgcagaatgaataccggtcccgtgggggctgcccggcagac
tggatttggctggtccctcccatgtctgggagcatcacccccgtgtttcaccaggagatg
ctgaactacgtcctgtcccctttctactactatcaggtagaggcctggaaaacccatgtc
tggcaggacgagaagcggagacccaagagaaaagagattccattgaaagtcttggtcaaa
gctgtgctctttgcctgtatgctgatgcgcaagacaatggcgtcccgagtcagagtcacc
atcctctttgcgacagagacaggaaaatcagaggcgctggcctgggacctgggggccttg
ttcagctgtgccttcaaccccaaggttgtctgcatggataactacaggctgagctgcctg
gaggaggagcggctgctgttggtggtgaccagtacgtttggcaatggagactgccccggc
aatggagagaaactgaagaaatcactcttcatgctgaaagagctcaacaacaaattcagg
tacgctgtgtttggcctcggctccagcatgtaccctcggttctgcgcctttgctcatgac
attgatcagaagctgtcccacctgggggcctctcagctcaccccgatgggagaaggggat
gagctcagtgggcaggaggacgccttccgcagctgggccgtgcaaaccttcaaggcagcc
tgtgagacgtttgatgtccgaggcaaacagcacattcagatccccaagctctacacctcc
aatgtgacctgggacccgcaccactacaggctcgtgcaggactcacagcctttggacctc
agcaaagccctcagcagcatgcacgccaagaacgtgttcaccatgaggctcaaatctcgg
cagaatctacaaagtccgacatccagccgtgccaccatcctggtggaactctcctgtgag
gatggcccaggcctgaactacctgccgggggagcaccttggggtttgcccaggcaaccag
ccggccctggtccaaggcatcctggagcgagtggtggatggccccacaccccaccagaca
gtgcgcctggaggccctggatgagagtggcagctactgggtcagtgacaagaggctgccc
ccctgctcactcagccaggccctcacctacttcctggacatcaccacacccccaacccaa
ctgctgctccaaaagctggcccaggtggccacagaagcgactgagagacagaggctggag
gccttgtgtcagccctcagagtacagcaagtggaagttcaccaacagccccacattcctg
gaggtgctagaggagttcccgtccctgcgggtgtctgctggcttcctgctttcccagctc
cccattctgaagcccaggttctactccatcagctcctcccgggatcacacgcccacggag
atccacctgactgtggctgtggtcacctaccacacccgagatggccagggtcccctgcac
cacggcgtctgcagcacatggctcaacagcctgaagccccaagacccagtgccctgcttt
gtgcggaatgccagcggtttccacctccccgaggatccctcccatccttgcatcctcatc
gggcctggcacaggcatcgcgcccttccgcagtttctggcagcaacggctccatgactcc
cagcacaagggagtgcggggaggccgcatgaccttggtgtttgggtgccgccgcccagat
gaggaccacatctaccaggaggagatgctggagatggcccagaagggggtgctgcatgag
gtgcatacagcctattcccgcctgcctggcaagcccaaggtctatgttcaggacatcctg
cggcagcagctggccagcgaggtgctccgtgtgctccacaaggagccaggccacctctat
gtttgcggggatgtgcgcatggcccgggacgtggcccacaccctgaagcagctggtggct
gccaacctgaaattgaatgaggagcaggttgaggactatttctttcagctcaagagccag
aagcgctatcacgaagatatctttggtgctgtatttccctacgaggcaaagaaggacagg
gcggcggtgcagcccagcagcctggagatgtcagtgctctga

DBGET integrated database retrieval system