KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135150
Entry
101135150         CDS       T02442                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1 isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00564  Glycerophospholipid metabolism
ggo00565  Ether lipid metabolism
ggo01100  Metabolic pathways
ggo04014  Ras signaling pathway
ggo04024  cAMP signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04144  Endocytosis
ggo04666  Fc gamma R-mediated phagocytosis
ggo04724  Glutamatergic synapse
ggo04912  GnRH signaling pathway
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo05200  Pathways in cancer
ggo05212  Pancreatic cancer
ggo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101135150 (PLD1)
   00565 Ether lipid metabolism
    101135150 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101135150 (PLD1)
   04072 Phospholipase D signaling pathway
    101135150 (PLD1)
   04071 Sphingolipid signaling pathway
    101135150 (PLD1)
   04024 cAMP signaling pathway
    101135150 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101135150 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101135150 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101135150 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    101135150 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101135150 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101135150 (PLD1)
   05231 Choline metabolism in cancer
    101135150 (PLD1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101135150 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101135150 (PLD1)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     101135150 (PLD1)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101135150 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    101135150 (PLD1)
SSDB
Motif
Pfam: PLDc_2 PX PLDc PH DUF3785
Other DBs
NCBI-GeneID: 101135150
NCBI-ProteinID: XP_018880232
Ensembl: ENSGGOG00000007868
UniProt: A0A2I2ZEZ5
LinkDB
Position
3
AA seq 1074 aa
MSLKNEPRVNTSALQKIAADMSNIIENLDTRELHFEGEEVEYDVSPSDPKIQEVYIPFSA
IYNTQGFKEPNIQTYLSGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVREEPREMPSLPRSSENMIREEQFLGRR
KQLEDYLTKILKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGIRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKHGTNFLKDHRFGSYAAIQENALAKWYVNAKG
YFEDVANAMEEANEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQQGVRIFIMLY
KEVELALGINSEYTKRTLIRLHPNIKVMRHPDHVSSTVYLWAHHEKLVIIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTSGPSLGSLPPAAMESMESLRLKDKNEPDQNLPIQKS
IDDVDSKLKGIGKPRKFSKFSLYKQLHRHHLHNADSISSIDSTSSYFNHYRSHHNLIHGL
KPHFKLFHPSSESEQGLTRPHADTGSIRSLQTGVGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRYSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELRYQVPGSVHANVQLLRSAADWSAGIKYHEESIHAAYVHVIENSRHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRENQKYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAKLGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGEEYQAGRFAQGLRLQCF
RVVLGYLDDPSEDIEDPVSDKFFKEVWVSTAARNATIYDKVFRCLPNDEVHNLIQLRDFI
NKPVLAKEDPIRAEEELKKIRGFLVQFPFYFLSEESLLPSVGTKEAIVPMEVWT
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgtcactgaaaaacgagccacgggtaaatacctctgcactgcagaaaattgctgctgac
atgagtaatatcatagaaaatctggacacgcgggaactccactttgagggagaggaggta
gaatacgacgtgtctcccagtgatcccaagatacaagaagtttatatccctttctctgct
atttataacactcaaggatttaaggagcctaatatacagacgtatctctccggctgtcca
ataaaagcacaagttctggaagtggaacgcttcacatctacaacaagggtaccaagtatt
aatctttacactattgaattaacacatggggaatttaaatggcaagttaagaggaaattc
aagcattttcaagaatttcacagagagctgctcaagtacaaagcctttatccgaatcccc
attcccactagaagacacacatttaggaggcaaaacgtcagagaggagcctcgagagatg
cccagtttgccccgttcatctgaaaacatgataagagaagaacaattccttggtagaaga
aaacaactggaagattacttgacaaagatactaaaaatgcccatgtatagaaactatcat
gccacaacagagtttcttgatataagccagctgtctttcatccatgatttgggaccaaag
ggcatagaaggtatgataatgaaaagatctggaggacacagaataccaggcttgaattgc
tgtggtcagggaagagcctgctacagatggtcaaaaagatggttaatagtgaaagattcc
tttttattgtatatgaaaccagacagcggtgccattgccttcgtcctgctggtagacaaa
gaattcaaaattaaggtggggaagaaggagacagaaacgaaatatggaatccgaattgat
aatctttcaaggacacttattttaaaatgcaacagctatagacatgctcggtggtgggga
ggggctatagaagaattcatccagaaacatggcaccaactttctcaaagatcatcgattt
gggtcatatgctgctatccaagagaatgctttagctaaatggtatgttaatgccaaagga
tattttgaagatgtggcaaatgcaatggaagaggcaaatgaagagatttttatcacagat
tggtggctgagtccagaaatcttcctgaaacgcccagtggttgagggaaatcgttggagg
ttggactgcattcttaaacgaaaagcacaacaaggagtgaggatcttcataatgctctac
aaagaggtggaactcgctcttggcatcaatagtgaatacaccaagaggactttgattcgt
ctacatcccaacataaaggtgatgagacacccggatcatgtgtcatccaccgtctatttg
tgggctcaccatgagaagcttgtcatcattgaccaatcggtggcctttgtgggagggatt
gacctggcctatggaaggtgggacgacaatgagcacagactcacagacgtgggcagtgtg
aagcgggtcacttcaggaccatctctgggttccctcccacctgccgcaatggagtctatg
gaatccttaagactcaaagataaaaatgagcctgatcaaaacctacccatccagaagagt
attgatgatgtggattcaaaactgaaaggaataggaaagccaagaaagttctccaaattt
agtctctacaagcagctccacaggcaccacctgcacaacgcagatagcatcagcagcatt
gacagcacctccagttattttaatcactatagaagtcatcacaatttaatccatggttta
aaaccccacttcaaactctttcacccatccagtgagtctgagcaaggactcactagacct
catgctgataccgggtccatccgcagtttacagacaggtgtgggagagctgcatggggaa
accagattctggcatggaaaggactactgcaatttcgtcttcaaagactgggttcaactt
gataaaccttttgctgatttcattgacaggtactccacgccccggatgccctggcatgac
attgcctctgcagtccatgggaaggcggctcgtgatgtggcacgtcacttcatccagcgc
tggaacttcacgaaaattatgaaatcaaaatatcggtccctttcttatccttttctgctt
ccaaagtctcaaacaacagcccatgagctgagatatcaagtgcctgggtctgtccatgct
aacgtacagttgctccgctctgctgctgattggtctgctggtataaagtaccatgaagag
tccatccacgccgcttacgtccatgtgatagagaacagcaggcactatatctatatcgaa
aaccagtttttcataagctgtgctgatgacaaagttgtgttcaacaagataggcgatgcc
attgcccagaggatcctgaaagctcacagggaaaaccagaaataccgggtatatgtcgtg
ataccacttctgccagggttcgaaggagacatttcaaccggcggaggaaatgctctacag
gcaatcatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttggacag
ttaaaagcaaagcttggtaatcagtggataaattacatatcattctgtggtcttagaaca
catgcagagctcgaaggaaacctagtcactgagcttatctatgtccacagcaagttgtta
attgctgatgataacactgttattattggctctgccaacataaatgaccgcagcatgctg
ggaaagcgtgacagtgaaatggctgtcattgtgcaagatacagagactgttccttcagta
atggatggagaagagtaccaagctggccgatttgcccaaggacttcggctacagtgcttt
agggttgtccttggctatcttgatgacccaagtgaggacattgaggatccagtgagtgac
aaattcttcaaggaggtgtgggtttcaacagcagctcgaaatgctacaatttatgacaag
gttttccggtgccttcccaatgatgaagtacacaatttaattcagctgagagactttata
aacaagcccgtattagctaaggaagatcccattcgagctgaggaggaactgaagaagatc
cgtggatttttggtgcaattccccttttatttcttgtctgaagaaagcctactgccttct
gttggaaccaaagaggccatagtgcccatggaggtttggacttaa

KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135996
Entry
101135996         CDS       T02442                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2 isoform X1
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00564  Glycerophospholipid metabolism
ggo00565  Ether lipid metabolism
ggo01100  Metabolic pathways
ggo04014  Ras signaling pathway
ggo04024  cAMP signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04144  Endocytosis
ggo04666  Fc gamma R-mediated phagocytosis
ggo04724  Glutamatergic synapse
ggo04912  GnRH signaling pathway
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo05200  Pathways in cancer
ggo05212  Pancreatic cancer
ggo05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101135996 (PLD2)
   00565 Ether lipid metabolism
    101135996 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101135996 (PLD2)
   04072 Phospholipase D signaling pathway
    101135996 (PLD2)
   04071 Sphingolipid signaling pathway
    101135996 (PLD2)
   04024 cAMP signaling pathway
    101135996 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101135996 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101135996 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101135996 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    101135996 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101135996 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101135996 (PLD2)
   05231 Choline metabolism in cancer
    101135996 (PLD2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    101135996 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101135996 (PLD2)
Enzymes [BR:ggo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     101135996 (PLD2)
Membrane trafficking [BR:ggo04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101135996 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    101135996 (PLD2)
SSDB
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Other DBs
NCBI-GeneID: 101135996
NCBI-ProteinID: XP_004058387
Ensembl: ENSGGOG00000006586
UniProt: G3QUP6
LinkDB
Position
17
AA seq 960 aa
MEDLRELGWGAGSAGQLASLRLPNVPRMTATPESLFPTGDELDSSQLQMESDEVDTLKEG
EDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTH
GDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAGNREMPSLPRAGPE
GSTRHAASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPDLGRKGLEGMIRKRS
GGHRVPGLTCCGRDQVCYRWSKRWLVVKDSFLLYMCLETGAISFVQLFDPGFEVQVGKRS
TEARHGVRIDTSHRSLILKCSSYRQARWWAQEITELAQGPGRDFLQLHQHDSYAPPRPGT
LARWFVNGAGYFAAVADAILRAQEEIFITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEE
GVRVSILLFKEVELALGINSGYSKRALMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVA
FLGGLDLAYGRWDDLHYRLTDLGDSSESAASQPPTLCPDSPATPDLSHNQFFWLGKDYSN
LITKDWVQLDRPFEDFIDRETTPRMPWRDVGVVVHGLPARDLARHFIQRWNFTKTTKAKY
KTPTYPYLLPKSTSTANQLPFTLPGGQCTSVQVLRSVDRWSAGTLENSILNAYLHTIRES
RHFLYIENQFFISCSDGRTVLNKVGDEIVDRILKAHKQGQCYRVYVLLPLLPGFEGDIST
GGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGGHPVSELI
YIHSKVLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTETEPSLMNGAEYQAGRFAL
SLRKHCFSVILGVNTRPDLDLRDPICDDFFQLWQDTAESNANIYEQIFRCLPSNATRSLR
TLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
NT seq 2883 nt   +upstreamnt  +downstreamnt
atggaggacctgcgggagttaggatggggggcgggttctgcaggacagctcgcctccctg
aggcttcccaatgttcctaggatgacggcgacccctgagagcctcttccccactggggac
gaactggactccagccagctccagatggagtccgatgaggtggacaccctgaaggaggga
gaggacccagccgaccggatgcacccgtttctggccatctatgagcttcagtctctgaaa
gtgcaccccttggtgttcgcacctggggtccctgtcacagcccaggtggtgggcaccgaa
agatataccagcggatccaaggtgggaacctgcactctgtattctgtccgcttgactcac
ggtgacttttcctggacaaccaagaagaaataccgtcattttcaggagctgcatcgggac
ctcctgagacacaaagtcttgatgagtctgctccctctggctcgatttgccgttgcctat
tctccagcccgagatgcaggcaacagagagatgccctctctaccccgggcaggtcctgag
ggctccaccagacatgcagccagcaaacagaaatacctggagaattacctcaaccgtctc
ttgaccatgtctttctatcgcaactaccatgccatgacagagttcctggaagtcagtcag
ctgtcctttatcccagacttgggccgcaaaggactggaggggatgatccggaagcgctca
ggtggccaccgtgttcctggcctcacctgctgtggccgagaccaagtttgttatcgctgg
tccaagaggtggctggtggtgaaggactccttcctgctgtacatgtgcctcgagacgggt
gccatctcatttgttcagctctttgaccctggctttgaggtgcaagtggggaaaaggagc
acggaggcacggcacggcgtgcggatcgatacctcccacaggtccttgattctcaagtgc
agcagctaccggcaggcacggtggtgggcccaagagatcactgagctggcacagggccca
ggcagagacttcctacagctgcaccagcatgacagctacgccccaccccggcctgggacc
ttggcccggtggtttgtgaatggggcaggttactttgctgctgtggcagatgccatcctt
cgagctcaggaggagattttcatcacagactggtggttgagtcctgaggtttacctgaag
cgtccggcccattcagatgactggagactggacattatgctcaagaggaaggcggaggag
ggtgtccgcgtgtctattctgctgtttaaagaagtggaattggccttgggcatcaacagt
ggctatagcaagagggcgctgatgctgctgcaccccaacataaaggtgatgcgtcaccca
gaccaagtgacgttgtgggcccatcatgagaagctcctggtggtggaccaagtggtagca
ttcctggggggactggaccttgcctatggccgctgggatgacctgcactaccgactgact
gaccttggagactcctctgaatcagctgcctcccagcctcccaccctgtgcccagactcg
ccagccaccccagacctctctcacaaccaattcttctggctgggcaaggactacagcaat
cttatcaccaaggactgggtgcagctggaccggcctttcgaagatttcattgacagggag
acgacccctcggatgccatggcgggacgttggggtggtcgtccatggcctaccagcccgg
gacctcgcccggcacttcatccagcgctggaacttcaccaagaccaccaaggccaagtac
aagactcccacatacccctacctgcttcccaagtctaccagcacggccaatcagctcccc
ttcacacttccaggagggcaatgcaccagcgtacaggtcttgcgatcagtggaccgctgg
tcagcagggactctggagaactccatcctcaacgcctacctgcacaccatcagggagagc
cggcacttcctctacattgagaatcagttcttcattagctgctcagatgggcggacggtt
ctgaacaaggtgggcgatgagattgtggacagaatcctgaaggcccacaaacaggggcag
tgttaccgagtctacgtgcttttgcccttactccctggcttcgagggtgacatctccacg
ggcggtggcaactccatccaggccattctgcactttacttacaggaccctgtgtcgtggg
gagtattcaatcctgcatcgcctcaaagcagccatggggacagcatggcgggactatatt
tccatctgcgggcttcgtacacacggagagctgggcgggcaccccgtctcggagctcatc
tacatccacagcaaggtgctcatcgcagatgaccggacagtcatcattggttctgcaaac
atcaatgaccggagcttgctggggaagcgggacagtgagctggccgtgctgatcgaggac
acagagacggaaccatccctcatgaatggggcagagtatcaggccggcaggtttgccttg
agtctgcggaagcactgcttcagtgtgattcttggagtaaatacccggccagacttggat
ctccgagaccccatctgtgatgacttcttccagttgtggcaagacacggctgagagcaac
gccaatatctatgagcagatcttccgctgcctgccatccaatgccacgcgttccctgcgg
actctccgggagtacgtggccgtggagcccttggccacagtcagtccccccttggctcgg
tctgagctcacccaggtccagggccacctggtccacttccctctcaagttcctagaggat
gagtctttgctgcccccgctgggtagcaaggagggcatgatccccctagaagtgtggaca
tag

DBGET integrated database retrieval system