KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101135800
Entry
101135800         CDS       T02442                                 

Gene name
PTK2B
Definition
(RefSeq) protein-tyrosine kinase 2-beta isoform X1
  KO
K05871  focal adhesion kinase 2 [EC:2.7.10.2]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04020  Calcium signaling pathway
ggo04062  Chemokine signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04650  Natural killer cell mediated cytotoxicity
ggo04670  Leukocyte transendothelial migration
ggo04912  GnRH signaling pathway
ggo05135  Yersinia infection
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101135800 (PTK2B)
   04072 Phospholipase D signaling pathway
    101135800 (PTK2B)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101135800 (PTK2B)
   04670 Leukocyte transendothelial migration
    101135800 (PTK2B)
   04062 Chemokine signaling pathway
    101135800 (PTK2B)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101135800 (PTK2B)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101135800 (PTK2B)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101135800 (PTK2B)
   05161 Hepatitis B
    101135800 (PTK2B)
   05163 Human cytomegalovirus infection
    101135800 (PTK2B)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101135800 (PTK2B)
Protein kinases [BR:ggo01001]
 Non-receptor tyrosine kinases
  FAK family
   101135800 (PTK2B)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Focal_AT FERM_N_2 Pkinase FERM_M Kinase-like FERM_F2
Other DBs
NCBI-GeneID: 101135800
NCBI-ProteinID: XP_030869643
Ensembl: ENSGGOG00000015589
LinkDB
Position
8
AA seq 1009 aa
MSGVSEPLSRVKLGTLRRPEGPAEPMVVVPVDVEKEDVRILKVCFYSNSFNPGKNFKLVK
CTVQTEIREIITSILLSGRIGPNIQLAECYGLRLKHMKSDEIHWLHPQMTVGEVQDKYEC
LHVEAEWRYDLQIRYLPEDFMESLKEDRTTLLYFYQQLRNDYMQRYASKVSEGMALQLGC
LELRRFFKDMPHNALDKKSNFELLEKEVGLDLFFPKQMQENLKPKQFRKMIQQTFQQYAS
LREEECVMKFFNTLAGFANIDQETYRCELIQGWNITVDLVIGPKGIRQLTSQDAKPTCLA
EFKQIRSIRCLPLEEGQAVLQLGIEGAPQALSIKTSSLAEAENMADLIDGYCRLQGEHQG
SLIIHPRKDGEKRNSLPQIPMLNLEARRSHLSESCSIESDIYAEIPDETLRRPGGPQYGI
AREDVVLNRILGEGFFGEVYEGVYTNHKGEKINVAVKTCKKDCTLDNKEKFMSEAVIMKN
LDHPHIVKLIGIIEEEPTWIIMELYPYGELGHYLERNKNSLKVLTLVLYSLQICKAMAYL
ESINCVHRDIAVRNILVASPECVKLGDFGLSRYIEDEDYYKASVTRLPIKWMSPESINFR
RFTTASDVWMFAVCMWEILSFGKQPFFWLENKDVIGVLEKGDRLPKPDLCPPVLYTLMTR
CWDYDPSDRPRFTELVCSLSDIYQMEKDIAMEQERNARYRTPKILEPTTFQEPPPKPSRP
KYRPPPQTNLLAPKLQFQVPEGLCASSPTLTSPMEYPSPVNSLHTPPLHRHNVFKRHSMR
EEDFIRPSSREEAQQLWEAEKVKMRQILDKQQKQMVEDYQWLRQEEKSLDPMVYMNDKSP
LTPEKEVGYLEFTGPPQKPPRLGAQSIQPTANLDRTDDLVYLNVMELVRAVLELKNELCQ
LPPEGYVVVVKNVGLTLRKLIGSVDDLLPSLPSSSRTEIEGTQKLLNKDLAELINKMRLA
QQNAVTSLSEECKRQMLTASHTLAVDAKNLLDAVDQAKVLANLAHPPAE
NT seq 3030 nt   +upstreamnt  +downstreamnt
atgtctggggtgtccgagcccctgagccgagtaaagttgggcacgttacgccggcctgaa
ggccctgcagagcccatggtggtggtaccagtagatgtggaaaaggaggacgtgcgtatc
ctcaaggtctgcttctatagcaacagcttcaatcctgggaagaacttcaaactggtcaaa
tgcactgtccagacggagatccgggagatcatcacctccatcctgctgagcgggcggatc
gggcccaacatccagttggctgagtgctatgggctgaggctgaagcacatgaagtccgat
gagatccactggctgcacccacagatgacggtgggtgaggtgcaggacaagtatgagtgt
ctgcacgtggaagccgagtggaggtatgaccttcaaatccgctacttgccagaagacttc
atggagagcctgaaggaggacaggaccacgctgctctatttttaccaacagctccggaat
gactacatgcagcgctacgccagcaaggtcagcgagggcatggccctgcagctgggctgc
ctggagctcaggcggttcttcaaggatatgccccacaatgcacttgacaagaagtccaac
ttcgagctcctagaaaaggaagtggggctggacttgtttttcccaaagcagatgcaggag
aacttaaagcccaaacagttccggaagatgatccagcagaccttccagcagtacgcctcg
ctcagggaggaggagtgcgtcatgaagttcttcaacactctcgcgggcttcgccaacatc
gaccaggagacctaccgctgtgaactcattcaaggatggaacattactgtggacctggtc
attggccctaaagggatccgccagctgactagtcaggacgcaaagcccacctgcctggcc
gagttcaagcagatcaggtccatcaggtgcctcccgctggaggagggccaggcagtactt
cagctgggcattgaaggtgccccccaggccttgtccatcaaaacctcgtccctagcagag
gctgagaacatggctgacctcatagacggctactgccggctgcagggggagcaccaaggc
tctctcatcatccatcctaggaaagatggtgagaagcggaacagcctgccccagatcccc
atgctaaacctggaggcccggcggtcccacctctcagagagctgcagcatagagtcagac
atctacgcagagattcccgacgaaaccctgcgaaggcccggaggtccacagtatggcatt
gcccgtgaagatgtggtcctgaatcgtattcttggggaaggcttttttggggaggtctat
gaaggtgtctacacaaatcacaaaggggagaaaatcaatgtagcagtcaagacctgcaag
aaagactgcactctggacaacaaggagaagttcatgagcgaggcagtgatcatgaagaac
ctcgaccacccgcacatcgtgaagctgatcggcatcattgaagaggagcccacctggatc
atcatggaattgtatccctatggggagctgggccactacctggagcggaacaagaactcc
ctgaaggtgctcaccctcgtgctgtactcactgcagatatgcaaagccatggcctacctg
gagagcatcaactgcgtgcacagggacattgctgtccggaacatcctggtggcctcccct
gagtgtgtgaagctgggggactttggtctttcccggtacattgaggacgaggactattac
aaagcctctgtgactcgtctccccatcaaatggatgtccccagagtccattaacttccga
cgcttcacgacagccagtgacgtctggatgttcgccgtgtgcatgtgggagatcctgagc
tttgggaagcagcccttcttctggctggagaacaaggatgtcatcggggtgctggagaaa
ggagaccggctgcccaagcctgatctctgtccaccggtcctttataccctcatgacccgc
tgctgggactacgaccccagtgaccggccccgcttcaccgagctggtgtgcagcctcagt
gacatttatcagatggagaaggacattgccatggagcaagagaggaatgctcgctaccga
acccccaaaatcttggagcccacaaccttccaggaacccccacccaagcccagccgacct
aagtacagaccccctccgcaaaccaacctcctggctccaaagctgcagttccaggttccc
gagggtctgtgtgccagctctcctacgctcaccagccctatggagtatccatctcccgtt
aactcactgcacaccccacctctccaccggcacaatgtcttcaaacgccacagcatgcgg
gaggaggacttcatccgacccagcagccgagaagaggcccagcagctgtgggaggctgaa
aaggtcaaaatgcggcaaatcctggacaaacagcagaagcagatggtggaggactaccag
tggctcaggcaggaggagaagtccctggaccccatggtttatatgaatgataagtcccca
ttgacgccagagaaggaggtcggctacctggagttcacagggcccccacagaagccccca
aggctgggcgcacagtccatccagcccacagctaacctggaccggaccgatgacctggtg
tacctcaatgtcatggagctggtgcgggccgtgctggagctcaagaatgagctctgtcag
ctgccccccgagggctatgtggtggtggtgaagaatgtggggctgaccctgcggaagctc
atcgggagcgtggatgatctcctgccttccttgccgtcgtcttcacggacagagatcgag
ggcacccagaaactgctcaacaaagacctggcagagctcatcaacaagatgcggctggct
cagcagaacgccgtgacatccctgagtgaggagtgcaagaggcagatgctgacggcttca
cacaccctggctgtggacgccaagaacctgctcgacgctgtggaccaggccaaggttctg
gccaatctggcccacccacctgcagagtga

DBGET integrated database retrieval system