KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136454
Entry
101136454         CDS       T02442                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X3
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo01521  EGFR tyrosine kinase inhibitor resistance
ggo01522  Endocrine resistance
ggo04010  MAPK signaling pathway
ggo04012  ErbB signaling pathway
ggo04014  Ras signaling pathway
ggo04015  Rap1 signaling pathway
ggo04022  cGMP-PKG signaling pathway
ggo04024  cAMP signaling pathway
ggo04062  Chemokine signaling pathway
ggo04068  FoxO signaling pathway
ggo04071  Sphingolipid signaling pathway
ggo04072  Phospholipase D signaling pathway
ggo04140  Autophagy - animal
ggo04150  mTOR signaling pathway
ggo04151  PI3K-Akt signaling pathway
ggo04210  Apoptosis
ggo04218  Cellular senescence
ggo04270  Vascular smooth muscle contraction
ggo04360  Axon guidance
ggo04370  VEGF signaling pathway
ggo04371  Apelin signaling pathway
ggo04510  Focal adhesion
ggo04540  Gap junction
ggo04550  Signaling pathways regulating pluripotency of stem cells
ggo04625  C-type lectin receptor signaling pathway
ggo04630  JAK-STAT signaling pathway
ggo04650  Natural killer cell mediated cytotoxicity
ggo04660  T cell receptor signaling pathway
ggo04662  B cell receptor signaling pathway
ggo04664  Fc epsilon RI signaling pathway
ggo04666  Fc gamma R-mediated phagocytosis
ggo04720  Long-term potentiation
ggo04722  Neurotrophin signaling pathway
ggo04726  Serotonergic synapse
ggo04730  Long-term depression
ggo04810  Regulation of actin cytoskeleton
ggo04910  Insulin signaling pathway
ggo04912  GnRH signaling pathway
ggo04914  Progesterone-mediated oocyte maturation
ggo04915  Estrogen signaling pathway
ggo04916  Melanogenesis
ggo04917  Prolactin signaling pathway
ggo04919  Thyroid hormone signaling pathway
ggo04921  Oxytocin signaling pathway
ggo04926  Relaxin signaling pathway
ggo04928  Parathyroid hormone synthesis, secretion and action
ggo04929  GnRH secretion
ggo04935  Growth hormone synthesis, secretion and action
ggo05010  Alzheimer disease
ggo05022  Pathways of neurodegeneration - multiple diseases
ggo05034  Alcoholism
ggo05132  Salmonella infection
ggo05152  Tuberculosis
ggo05160  Hepatitis C
ggo05161  Hepatitis B
ggo05163  Human cytomegalovirus infection
ggo05164  Influenza A
ggo05165  Human papillomavirus infection
ggo05167  Kaposi sarcoma-associated herpesvirus infection
ggo05170  Human immunodeficiency virus 1 infection
ggo05200  Pathways in cancer
ggo05205  Proteoglycans in cancer
ggo05206  MicroRNAs in cancer
ggo05210  Colorectal cancer
ggo05211  Renal cell carcinoma
ggo05212  Pancreatic cancer
ggo05213  Endometrial cancer
ggo05214  Glioma
ggo05215  Prostate cancer
ggo05218  Melanoma
ggo05219  Bladder cancer
ggo05220  Chronic myeloid leukemia
ggo05221  Acute myeloid leukemia
ggo05223  Non-small cell lung cancer
ggo05224  Breast cancer
ggo05225  Hepatocellular carcinoma
ggo05226  Gastric cancer
ggo05230  Central carbon metabolism in cancer
ggo05231  Choline metabolism in cancer
ggo05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101136454 (RAF1)
   04012 ErbB signaling pathway
    101136454 (RAF1)
   04014 Ras signaling pathway
    101136454 (RAF1)
   04015 Rap1 signaling pathway
    101136454 (RAF1)
   04370 VEGF signaling pathway
    101136454 (RAF1)
   04371 Apelin signaling pathway
    101136454 (RAF1)
   04630 JAK-STAT signaling pathway
    101136454 (RAF1)
   04068 FoxO signaling pathway
    101136454 (RAF1)
   04072 Phospholipase D signaling pathway
    101136454 (RAF1)
   04071 Sphingolipid signaling pathway
    101136454 (RAF1)
   04024 cAMP signaling pathway
    101136454 (RAF1)
   04022 cGMP-PKG signaling pathway
    101136454 (RAF1)
   04151 PI3K-Akt signaling pathway
    101136454 (RAF1)
   04150 mTOR signaling pathway
    101136454 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101136454 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    101136454 (RAF1)
   04218 Cellular senescence
    101136454 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101136454 (RAF1)
   04540 Gap junction
    101136454 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101136454 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101136454 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101136454 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    101136454 (RAF1)
   04660 T cell receptor signaling pathway
    101136454 (RAF1)
   04662 B cell receptor signaling pathway
    101136454 (RAF1)
   04664 Fc epsilon RI signaling pathway
    101136454 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    101136454 (RAF1)
   04062 Chemokine signaling pathway
    101136454 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101136454 (RAF1)
   04929 GnRH secretion
    101136454 (RAF1)
   04912 GnRH signaling pathway
    101136454 (RAF1)
   04915 Estrogen signaling pathway
    101136454 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    101136454 (RAF1)
   04917 Prolactin signaling pathway
    101136454 (RAF1)
   04921 Oxytocin signaling pathway
    101136454 (RAF1)
   04926 Relaxin signaling pathway
    101136454 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    101136454 (RAF1)
   04919 Thyroid hormone signaling pathway
    101136454 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    101136454 (RAF1)
   04916 Melanogenesis
    101136454 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101136454 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    101136454 (RAF1)
   04720 Long-term potentiation
    101136454 (RAF1)
   04730 Long-term depression
    101136454 (RAF1)
   04722 Neurotrophin signaling pathway
    101136454 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    101136454 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101136454 (RAF1)
   05206 MicroRNAs in cancer
    101136454 (RAF1)
   05205 Proteoglycans in cancer
    101136454 (RAF1)
   05230 Central carbon metabolism in cancer
    101136454 (RAF1)
   05231 Choline metabolism in cancer
    101136454 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101136454 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101136454 (RAF1)
   05212 Pancreatic cancer
    101136454 (RAF1)
   05225 Hepatocellular carcinoma
    101136454 (RAF1)
   05226 Gastric cancer
    101136454 (RAF1)
   05214 Glioma
    101136454 (RAF1)
   05221 Acute myeloid leukemia
    101136454 (RAF1)
   05220 Chronic myeloid leukemia
    101136454 (RAF1)
   05218 Melanoma
    101136454 (RAF1)
   05211 Renal cell carcinoma
    101136454 (RAF1)
   05219 Bladder cancer
    101136454 (RAF1)
   05215 Prostate cancer
    101136454 (RAF1)
   05213 Endometrial cancer
    101136454 (RAF1)
   05224 Breast cancer
    101136454 (RAF1)
   05223 Non-small cell lung cancer
    101136454 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101136454 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    101136454 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    101136454 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101136454 (RAF1)
   05152 Tuberculosis
    101136454 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101136454 (RAF1)
   05161 Hepatitis B
    101136454 (RAF1)
   05160 Hepatitis C
    101136454 (RAF1)
   05164 Influenza A
    101136454 (RAF1)
   05163 Human cytomegalovirus infection
    101136454 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101136454 (RAF1)
   05165 Human papillomavirus infection
    101136454 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101136454 (RAF1)
   01522 Endocrine resistance
    101136454 (RAF1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101136454 (RAF1)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   101136454 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase C1_1 Kinase-like zf-RING-like Pkinase_fungal RBD C1_2 zf-C3HC4_2 zf-RING_2
Other DBs
NCBI-GeneID: 101136454
NCBI-ProteinID: XP_018879253
Ensembl: ENSGGOG00000023025
LinkDB
Position
3
AA seq 567 aa
MMANSQILLRQATLSVFSCRTSKEQCKKARLDWNTDAASLIGEELQVDFLDHVPLTTHNF
ARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKVPTMCVDWSNIRQLLLFPNSTI
GDSGVPALPSLTMRRMRESVSRMPVSSQHRYSTPHAFTFNTSSPSSEGSLSQRQRSTSTP
NVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNLSPTGWSQPKTPVPAQRERAPV
SGTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSFGTVYKGKWHGDVAVKILKVVD
PTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIVTQWCEGSSLYKHLHVQETKFQ
MFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGLTVKIGDFGLATVKSRWSGSQQ
VEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYELMTGELPYSHINNRDQIIFMV
GRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFPQILSSIELLQHSLPKINRSAS
EPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1704 nt   +upstreamnt  +downstreamnt
atgatggcaaactcacagatccttctaagacaagcaacactatccgtgttttcttgccga
acaagcaaagaacagtgtaaaaaagcacgcttagattggaatactgatgctgcgtctttg
attggagaagaacttcaagtagatttcctggatcatgttcccctcacaacacacaacttt
gctcggaagacgttcctgaagcttgccttctgtgacatctgtcagaaattcctgctcaat
ggatttcgatgtcagacttgtggctacaaatttcatgagcactgtagcaccaaagtacct
actatgtgtgtggactggagtaacatcagacaactcttattgtttccaaattccactatt
ggtgatagtggagtcccagcactaccttctttgactatgcgtcgtatgcgagagtctgtt
tccaggatgcctgttagttctcagcacagatattctacacctcacgccttcacctttaac
acctccagtccctcatctgaaggttccctctcccagaggcagaggtcgacgtccacacct
aatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgaggatgcaatt
cgaagtcacagcgaatcagcctcaccttcagccctgtccagtagccccaacaatctgagc
ccaacaggctggtcacagccgaaaacccccgtgccagcacaaagagagcgggcaccagta
tctgggacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctattat
tgggaaatagaagccagtgaagtgatgctgtccactcggattgggtcaggctcttttgga
actgtttataagggtaaatggcacggagatgttgcagtaaagatcctaaaggttgtcgac
ccaaccccagagcaattccaggccttcaggaatgaggtggctgttctgcgcaaaacacgg
catgtgaacattctgcttttcatggggtacatgacaaaggacaacctggcaattgtgacc
cagtggtgcgagggcagcagcctctacaaacacctgcatgtccaggagaccaagtttcag
atgttccagctaattgacattgcccggcagacggctcagggaatggactatttgcatgca
aagaacatcatccatagagacatgaaatccaacaatatatttctccatgaaggcttaaca
gtgaaaattggagattttggtttggcaacagtaaagtcacgctggagtggttctcagcag
gttgaacaacctactggctctgtcctctggatggccccagaggtgatccgaatgcaggat
aacaacccattcagtttccagtcagatgtctactcctatggcatcgtattgtatgaactg
atgacgggggagcttccttattctcacatcaacaaccgagatcagatcatcttcatggtg
ggccgaggatatgcctccccagatcttagtaagctatataagaactgccccaaagcaatg
aagaggctggtagctgactgtgtgaagaaagtaaaggaagagaggcctctttttccccag
atcctgtcttccattgagctgctccaacactctctaccgaagatcaaccggagcgcttcc
gagccatccttgcatcgggcagcccacactgaagatatcaatgcttgcacgctgaccacg
tccccgaggctgcctgtcttctag

DBGET integrated database retrieval system