KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136722
Entry
101136722         CDS       T02442                                 

Gene name
MAP3K1
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 1
  KO
K04416  mitogen-activated protein kinase kinase kinase 1 [EC:2.7.11.25]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04010  MAPK signaling pathway
ggo04120  Ubiquitin mediated proteolysis
ggo04530  Tight junction
ggo04622  RIG-I-like receptor signaling pathway
ggo04722  Neurotrophin signaling pathway
ggo04912  GnRH signaling pathway
ggo04935  Growth hormone synthesis, secretion and action
ggo05161  Hepatitis B
ggo05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    101136722 (MAP3K1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101136722 (MAP3K1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101136722 (MAP3K1)
 09150 Organismal Systems
  09151 Immune system
   04622 RIG-I-like receptor signaling pathway
    101136722 (MAP3K1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101136722 (MAP3K1)
   04935 Growth hormone synthesis, secretion and action
    101136722 (MAP3K1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101136722 (MAP3K1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101136722 (MAP3K1)
   05161 Hepatitis B
    101136722 (MAP3K1)
Enzymes [BR:ggo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101136722 (MAP3K1)
Protein kinases [BR:ggo01001]
 Serine/threonine kinases: STE group
  STE11 family
   101136722 (MAP3K1)
Ubiquitin system [BR:ggo04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    101136722 (MAP3K1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal zf-RING_2 PHD Phostensin_N APH FANCL_C zf-ANAPC11
Other DBs
NCBI-GeneID: 101136722
NCBI-ProteinID: XP_030859362
Ensembl: ENSGGOG00000014603
LinkDB
Position
17
AA seq 1508 aa
MAAAAGNRASSSGFPGAGAASPEAGGGGGALKASSAPAAAAGLLREAGSGGRERAEWRRR
QLRKVRSVELDQLPEQPLFLAASPPSSSTSPSPEPADAAGSGTGFQPVAVPPPHGAASRG
GAHLAESVAATDSGASSPAAAEPGEKRAPAAEPSPAAAPAGREMENKETLKGLHKMDDRP
EERMIREKLKATCMPAWKHEWLERRNRRGPVVVKPIPVKGDGSEMNHLAAESPGEAQASA
ASPASKGRRSPSPGNSPSGRTVKSESPGVRRKRVSPVPFQSGRITPPRRAPSPDGFSPYS
PEETNRRVNKVMRARLYLLQQIGPNSFLIGGDSPDNKYRVFIGPQNCSCARGTFCIHLLF
VMLRVFQLEPSDPMLWRKTLKNFEVESLFQKYHSRRSSRIKAPSRNTIQKFVSRMSNSHT
LSSSSTSTSSSENSIKDEEEQMCPICLLGMLDEESLTVCEDGCRNKLHHHCMSIWAEECR
RNREPLICPLCRSKWRSHDFYSHELSSPVDSPSSLRAAQQQTIQQQPLAGSQRRNQESNF
NLTHYGTQQIPPAYKDLAEPWIQVFGMELVGCLFSRNWNVREMALRRLSHDVSGALLLAN
GESTGNSGGSSGSSPSGGATSGSSQTSISGDVVEACCSVLSMVCADPVYKVYVAALKTLR
AMLVYTPCHSLAERIKLQRLLQPVVDTILVKCADANSRTSQLSISTLLELCKGQAGELAI
GREILKAGSIGIGGVDYVLNCILGNQTESNNWQELLGRLCLIDRLLLEFPAEFYPHIVST
DVSQAEPVEIRYKKLLSLLTFALQSIDNSHSMVGKLSRRIYLSSARMVTTVPHVFSKLLE
MLSVSSSTHFTRMRRRLMAIADEVEIAEAIQLGVEDTLDGQQDSFLQASIPNNYLETTEN
STPECTIHLEKTGKGLCATKLSASSEDISERLASISVGPSSSTTTEQPKPMVQTKGRPHS
QCLNSSPLSHHSQLMFPALSTPSSSTPSVPAGTATDVSKHRLQGFIPCRIPSASPQTQRK
FSLQFHRNCPENKDSDKLSPVFTQSRPLPSSNIHRPKPSRPTPGNTSKQGDPSKNSMTLD
LNSSSKCDDSFGCSSNSSNAVIPSDETVFTPVEEKCRLDVNTELNSSIEDLLEASMPSSD
TTVTFKSEVAVLSPEKAENDDTYKDDVNHNQKCKEKMEAEEEEALAIAMAMSASQDALPI
VPQLQVENGEDIIIIQQDTPETLPGHTKAKQPYREDTEWLKGQQIGLGAFSSCYQAQDVG
TGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSHLNHPNIIRMLGATCEKSNYNLFIE
WMAGGSVAHLLSKYGAFKESVVINYTEQLLRGLSYLHENQIIHRDVKGANLLIDSTGQRL
RIADFGAAARLASKGTGAGEFQGQLLGTIAFMAPEVLRGQQYGRSCDVWSVGCAIIEMAC
AKPPWNAEKHSNHLALIFKIASATTAPSIPSHLSPGLRDVALRCLELQPQDRPPSRELLK
HPVFRTTW
NT seq 4527 nt   +upstreamnt  +downstreamnt
atggcggcggcggcggggaatcgcgcctcgtcgtcgggattcccgggcgccggggctgcg
agccctgaggcgggcggcggcggaggagccctcaaggcgagcagcgcgcccgcggctgcc
gcgggactgctgcgggaggcgggcagcgggggccgcgagcgggcggagtggcggcggcgg
cagctgcgcaaagtgcggagtgtggagctggaccagctgcctgagcagccgctcttcctt
gccgcctcaccgccgtcctcctcgacttccccgtcgccggagcccgcggacgcagcgggg
agtgggaccggcttccagcctgtggcggtgccgccgccccacggagccgcgagccgcggc
ggcgcccaccttgccgagtcggtggcggcgacggacagcggcgcctcgagtcccgcagcg
gccgagcccggggagaagcgggcgcccgccgccgagccgtctcctgcagcggcccccgcc
ggtcgtgagatggagaataaagaaactctcaaagggttgcacaagatggatgatcgtcca
gaggaacgaatgatcagggagaaactgaaggcaacctgtatgccagcctggaagcacgaa
tggttggaaaggagaaataggcgagggcctgtggtggtaaaaccaatcccagttaaagga
gatggatctgaaatgaatcacttagcagctgagtctccaggagaggcccaggcaagtgcg
gcttcaccagcttccaaaggccgacgcagtccttctcctggcaactccccatcaggtcgc
acagtgaaatcagaatctccaggagtaaggagaaaaagagtttccccagtgccttttcag
agtggcagaatcacaccaccccgaagagccccttcaccagatggcttctcaccatatagc
cctgaggaaacaaaccgccgtgttaacaaagtgatgcgggccagactatacttactgcag
cagatagggcctaactctttcctgattggaggagacagcccagacaataaataccgggtg
tttattgggcctcagaactgcagctgtgcacgtggaacattctgtattcatctgctattt
gtgatgctccgggtgtttcaactagaaccttcagacccaatgttatggagaaaaacttta
aagaattttgaggttgagagtttgttccagaaatatcacagtaggcgtagctcaaggatc
aaagctccatctcgtaacaccatccagaagtttgtttcacgcatgtcaaattctcataca
ttgtcatcatctagtacttctacatctagttcagaaaacagcataaaggatgaagaggaa
cagatgtgtcctatttgcttgttgggcatgcttgatgaagaaagtcttacagtttgtgaa
gacggctgcaggaacaagctgcaccaccactgcatgtcaatttgggcagaagagtgtaga
agaaatagagaacctttaatatgtcccctttgtagatctaagtggagatctcatgatttc
tacagccacgagttgtccagtcctgtggattccccttcttccctcagagctgcacagcag
caaaccatacagcagcagcctttggctggatcacaaagaaggaatcaagagagcaatttt
aaccttactcattatggaactcagcaaatccctcctgcttacaaagatttagctgagcca
tggattcaggtgtttggaatggaactcgttggctgcttattttctagaaactggaatgtg
agagagatggccctcaggcgtctttcccatgatgtcagtggggccctgctgttggcaaat
ggggagagcactggaaattctgggggcagcagtggaagcagcccgagtgggggagccacc
agtgggtcttcccagaccagtatctcaggagatgtggtggaggcatgctgcagcgttctg
tcaatggtctgtgctgaccctgtctacaaagtgtacgttgctgctttaaaaacattgaga
gccatgctggtatatactccttgccacagtttagcggaaagaatcaaacttcagagactt
ctgcagccagttgtagacaccatcctagtcaaatgtgcagatgccaatagccgcacaagt
cagctgtccatatcaacactgttggaactgtgcaaaggccaagcaggagagttggcaatt
ggcagagaaatactaaaagctggatccattggtattggtggtgttgattatgtcttaaat
tgtattcttggaaaccaaactgaatcaaacaattggcaagaacttcttggccgcctttgt
cttatagatagactgttgttggaatttcctgctgaattttatcctcatattgtcagtact
gatgtttcacaagctgagcctgttgaaatcaggtataagaagctgctgtccctcttaacc
tttgctttgcagtccattgataattcccactcaatggttggcaaactttccagaaggatc
tacttgagttctgcaagaatggttactacagtaccccatgtgttttcaaaactgttagaa
atgctgagtgtttccagttccactcacttcaccaggatgcgtcgccgtttgatggctatt
gcagatgaggtggaaattgccgaagccatccagttgggcgtagaagacactttggatggt
caacaggacagcttcttgcaggcatctattcccaacaactatctggaaaccacagagaac
agtacccctgagtgcacaatccatttagagaaaactggaaaaggattatgtgctacaaaa
ttgagtgccagttcagaggacatttctgagagactggccagcatttcagtaggaccttct
agttcaacaacaacagagcaaccaaagccaatggttcaaacaaaaggcagaccccacagt
cagtgtttgaactcctctcctttatctcatcattcccaattaatgtttccagccttgtca
accccttcttcttcgaccccatctgtaccagctggcactgcaacagatgtctctaagcat
agacttcagggattcattccctgcagaataccttctgcatctcctcaaacacagcgcaag
ttttctctacaattccacagaaactgtcctgaaaacaaagactcagataaactttcccca
gtctttactcagtcaagacccttgccctccagtaacatacacaggccaaagccatctcga
cctaccccaggtaatacaagtaaacagggagatccctcaaaaaatagcatgacacttgat
ctgaacagtagttccaaatgtgatgacagctttggctgtagcagcaatagtagtaatgct
gttatacccagtgacgagacagtgttcaccccagtggaggagaaatgcagattagatgtc
aatacagagctcaactccagtattgaggaccttcttgaagcatctatgccttcaagtgat
acaacagtaacttttaagtcagaagttgctgtcctgtctcctgaaaaggctgaaaatgat
gatacctacaaagatgatgtgaatcataatcaaaagtgcaaagagaagatggaagctgaa
gaagaagaagctttagcaattgccatggcaatgtcagcgtctcaggatgccctccccata
gttcctcagctgcaggttgaaaatggagaagatatcatcattattcaacaggatacacca
gagactctaccaggacataccaaagcaaaacaaccgtatagagaagacactgaatggctg
aaaggtcaacagataggccttggagcattttcttcttgttatcaggctcaagatgtggga
actggaactttaatggctgttaaacaggtgacttatgtcagaaacacatcttctgagcaa
gaagaagtagtagaagcactaagagaagagataagaatgatgagccatctgaatcatcca
aacatcattaggatgttgggagccacgtgtgagaagagcaattacaatctcttcattgaa
tggatggcagggggatcggtggctcatttgctgagtaaatatggagccttcaaagaatca
gtagttattaactacactgaacagttactccgtggcctttcgtatctccatgaaaaccaa
atcattcacagagatgtcaaaggtgccaatttgctaattgacagcactggtcagagacta
agaattgcagattttggagctgcagccaggttggcatcaaaaggaactggtgcaggagag
tttcagggacaattactggggacaattgcatttatggcacctgaggtactaagaggtcaa
cagtatggaaggagctgtgatgtatggagtgttggctgtgctattatagaaatggcttgt
gcaaaaccaccatggaatgcagaaaaacactccaatcatcttgctttgatatttaagatt
gctagtgcaactactgctccatcgatcccttcacatttgtctcctggtttacgagatgtg
gctcttcgttgtttagaacttcaacctcaggacagacctccatcaagagagctactgaag
catccagtctttcgtactacatggtag

DBGET integrated database retrieval system